SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012840 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012840
Domain Number 1 Region: 11-77
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 3.88e-16
Family Ovomucoid domain III-like 0.0053
Further Details:      
 
Domain Number 2 Region: 204-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000542
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 3 Region: 112-169
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000347
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012840   Gene: ENSSHAG00000010984   Transcript: ENSSHAT00000012945
Sequence length 317
Comment pep:novel scaffold:DEVIL7.0:GL841486.1:780748:920639:-1 gene:ENSSHAG00000010984 transcript:ENSSHAT00000012945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNVRESDVRVCDESTCKYGGLCKEDGEGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRR
ASCKHQKEITVVSRGPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENV
GCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCVKQEQIDIRHLGHCTDTDDTSLLGK
KDDGLQYRPDVKDASDQREDIYIGNHIPCPENFNGYCIHGKCEFIYSTQKASCRCESGYT
GQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITSTNRKCPKNNRGRR
QKQNLGHFTSDTSSRMV
Download sequence
Identical sequences G3WBN5
ENSSHAP00000012840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]