SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013057 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013057
Domain Number 1 Region: 10-195
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000000000000034
Family Rhomboid-like 0.013
Further Details:      
 
Domain Number 2 Region: 294-343
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000109
Family UBA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013057   Gene: ENSSHAG00000011167   Transcript: ENSSHAT00000013163
Sequence length 343
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849852.1:809455:1006993:-1 gene:ENSSHAG00000011167 transcript:ENSSHAT00000013163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYYQVKSTDKAPLSKSLLLVPSALSILLALLFQHYQNFFVYNLQAVKNDLQIWRLICGRI
ICLDLKDTFCSSLLIYNFRIFERRYGSRKFASFLLGSWILSALFDLILVEAIQYSFGITA
SNLPSGFLGPVFALFVPFYCSIPRVQVTQFLGQFSITNKTLIYILGLQLLTSGTYIWVVA
TSGLIAGMCYTNSVLKVHQVLCIPRWMAKLFSWTLEPIFSSSEPTNEVRIGMGATVDIQR
QQRMELLDRQLMLSQFAHMRRQQQQQGRRINWNRFFPHIRQRRNANVRAFRLSEQEVAAP
PLEVSEEQVARLMEMGFSRVDALEALRASNNDLNVATNFLLQH
Download sequence
Identical sequences G3WCA2
ENSSHAP00000013057 ENSSHAP00000013057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]