SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013063 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013063
Domain Number 1 Region: 476-821
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 4.71e-116
Family Rap/Ran-GAP 0.000000532
Further Details:      
 
Domain Number 2 Region: 949-1025
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000173
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013063   Gene: ENSSHAG00000011171   Transcript: ENSSHAT00000013169
Sequence length 1705
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856804.1:810451:1072444:1 gene:ENSSHAG00000011171 transcript:ENSSHAT00000013169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPRQSQEETHQFPRAPSKFKDSPRTMQSDDYFARKFKALNGNMGPPTSLSVANVAESG
GPANGTPAMPKMGVRARVSEWPPKKDCSKEMSCKALWESRSQASYETAVAAAVLQNGQNE
QGEGPPEEQLDLEFAEAKYTIGDIFIHSPQRAGLHPIRQRSNSDVTISDIDAEDVLDQNA
VNPNTGAALHREYGSTSSIDRQGLSGENFFAMLRGYRVDSYEHKALAPFGFPEFFHCDPA
ISPSLHAAAQISRGEFVRISGLEYMDNALLMGREREKNFKRRLKSESVETSLFRKLRTVK
SEHETFKFPPDLEESRLERSIRPWNCQKCFAHYDVQSILFNINEAMATRANVGKRKNITT
GASAASQTQMAAGQAGTCESPLGSKEDLNSKENLDADEGDGKSNDLVLSCPYFRNETGGE
GDRRIALSRANSTSSSAGESCSFESSLSSHCTNAGVSVLEVPRENQPIHREKVKRYIIEH
IDLGAYYYRKFFFGKEHQNYFGIDENLGPVAVSIRREKLEETKEKEGSQFNYRVAFRTSE
LTTLRGAILEDAIPSTARHGTARGLPLKEVLEYVIPELSIQCLRQALNSPKVSEQLLKLD
EQGLSFQHKIGILYCKAGQGTEEEMYNNETAGPAFEEFLDLLGQRVRLKGFSKYRAQLDT
KTDSTGTHSLYTTYKDYEVMFHVSTMLPYMPNNRQQLLRKRHIGNDIVTIVFQEPGALPF
TPKNIRSQFQHVFVIVKVHNPCTENVCYSVGVSRSKDVPPFGPPIPKGVTFPKSAVFRDF
LLAKVINAENSAHKSEKFRAMATRTRQEYLKDLAENFVTTATVDTSVKFSFITLGAKKKE
KVKPRKDAHLYSVGAIMWNVIARDFGRSADIECLLGISNEFIMLIEKESKNVVFNCSCRD
VIGWTSGLMSIKVFYERGECILLSTVDNCTDDIREIVQRLGIVTRGCETVEMTLRRNGLG
QLGFHVNFEGIVADVEPFGFAWKAGLRQGSRLVEICKVAVATLTHEQMIDLLRTSVTVKV
VIIQPHEDGSPRRGCSELCRIPMVEYKLDSEGTPCEYKTPFRRNTTWHRVPTPAGQPLSR
ASPILGTADRLPCQQLLQQAQTAIPRSTSFDRKLPDGTRSSPSNQSSSSDPGPSGSSHWR
QQVGYDGCQSPLLHEHQSSGPLECEGAREREEIMEGTRLSETKWHGPPSKVLSSYKERAL
QKEGSCKDSPNKLSHIGDKNCSSHSSSNTLSSNTSSNSDDKHFGSGDLMDPELLGLTYIK
GASTDSGIDTTPCMSTSMMGPLHLTGSRSMMHSRAEQWADAAEGPGPEEEQPKLYAVHSY
PSAISVSNTAEGSLGDLSEISSHSSGSHHSGSPSAHCSKNSGSLDTSKVYIVSHNSGQQV
TGSVSKSYHRQGAVSKYVIGWKKSEGSPTPEESEVNECQGMYSDMEAMSTSSQHQAVVED
AVSETQHVLSKEDFLKLMLPGSPLVEEGRRKFSFYGNLSPRRSLYRTLSDESICSNRRGS
SFGSSRSSILDQALPNDILFSTTPPYHSTLPPRTNPAPGLGSLRNEFWLSDGSLSDKSKF
TDPGLMPLPDTATGLDWSNLVDAARAFEDQRVASFCTLTDMQHMQGLEGTQELSLCVDPA
NGKDFMDTDGERSPSTLTGKVNQLELILRQLQTDLRKEKQDKAVLQAEVQHLRQDNMRLQ
EESQTAAAQLRKFTEWFFNTIDKKT
Download sequence
Identical sequences G3WCA8
ENSSHAP00000013063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]