SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013069 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013069
Domain Number 1 Region: 9-113
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.96e-40
Family Regulator of G-protein signaling, RGS 0.0000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013069   Gene: ENSSHAG00000011177   Transcript: ENSSHAT00000013175
Sequence length 120
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856767.1:811163:816256:1 gene:ENSSHAG00000011177 transcript:ENSSHAT00000013175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLDGPIIYAAYLKMEHSEENMKFWLACETYKKSASRFIRISKAKKLYKTYIQPQSPREI
NIDSPTREAIIKNIQEPTQNCFDEAQKIVYMHMERDSYPRFLRSELYQNLIESLQLDSHT
Download sequence
Identical sequences G3WCB4
ENSSHAP00000013069 ENSSHAP00000013069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]