SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013087 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013087
Domain Number 1 Region: 11-71
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000913
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013087   Gene: ENSSHAG00000011191   Transcript: ENSSHAT00000013193
Sequence length 211
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856861.1:813048:813683:1 gene:ENSSHAG00000011191 transcript:ENSSHAT00000013193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGESKESVGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSCKVDGQIQRTII
CPICRYVTFLSKKSSRWPSLSSEKNLQTLVVPMGLDNLPLGHTNPLTIPHPLWVSSQGQT
NQSPFPRDLLPGLVQEPQIFIISSHGMPLREEDSVLPRQSLANLSEVSPARRSSLCSRCC
HSRVMLLIALITVVAVIATILPWILLVRKEA
Download sequence
Identical sequences G3WCD2
ENSSHAP00000013087 ENSSHAP00000013087 XP_003768769.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]