SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013100 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013100
Domain Number 1 Region: 935-1113
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-20
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 625-694
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000653
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 316-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000196
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 4 Region: 682-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000212
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 5 Region: 471-591
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 6 Region: 720-762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000435
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 758-801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000671
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 8 Region: 240-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 9 Region: 1240-1278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000305
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 10 Region: 361-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000347
Family EGF-type module 0.009
Further Details:      
 
Domain Number 11 Region: 588-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family EGF-type module 0.024
Further Details:      
 
Domain Number 12 Region: 280-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000589
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 798-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000625
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 200-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000189
Family EGF-type module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013100   Gene: ENSSHAG00000011201   Transcript: ENSSHAT00000013206
Sequence length 1343
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849917.1:814235:861740:1 gene:ENSSHAG00000011201 transcript:ENSSHAT00000013206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNNNGIISFLKEVSQFTPVAFPISRDRCVVAAFWADVDNRRAGEVYYRESKEQPTLQRAT
EDIWRYFPELPDFQAQWVFVATWHRVTFFGGSSVSPVNTFQIVLITDGNLSFTIFNYESI
VWTTGMHASSGGDLAGLGGIAAQAGFNAGDGKRYFNIPGSRTDDIVNVEMTTNVGIPGRW
VFRIDDAQVQVGGCSNTTSVCLTLRPCLNGGKCIDDCITGNPSYTCSCLAGFTGKKCHLD
VNECASHPCQNGGTCTHGVNTFSCQCPPGFKGPTCGTVQSPCDAKACQNGGECRAANGTA
VCVCQPGYTGESCEIDINECDSDPCLNGGKCVDLVANYTCLCSEPFTGPRCELGGPRIPS
ACLSNPCQNEGTCLETDQGYICECPDGYTGHNCAEKLPEDCECRNGGRCLDGNFTICHCP
PGYFGLLCEFEVTATPCNVNTQCPDGGYCMEYGGSYLCVCHTDYGTNHSLPSPCDSDPCL
NGGSCDAHDDSYTCECPRGFHGKHCEKVRPRLCSSGPCRNGGTCKESNGEYQCSCPYRFT
GKHCEIGKPDSCASGPCQNGGTCFHYIGKYKCDCPPGYSGRHCEIAPSPCFMSPCENGAT
CNDLGTDYSCRCRAGYTGKRCQLEVDCGPPSSVKNTRVRFNSTKMGSLAEYECEQGYVLS
SGNNPRVCRAHGLWSEPPQCDEVDECESQPCLNGGSCKDRIAGFLCVCGSGYAGPHCELD
IDECQSDPCKNGGTCRDLPAAFVCRCPDGFAGIHCEKEVDACDSGPCQHGGECENDGGSY
LCVCPEGFFGYHCEIASDPCFSNPCGGRGYCLSSNGSHSCTCKVGYTGRNCAKGTQPARS
SPFQKALASLKLRTICSPALSERRTKGLSFGVTSLKSEGGRREQRPPRDGLSSLPGLNLW
PYNCNKSLSPFSPRGTCCTPGSWAPPPTDASPPGPRPVQGFEITNVTASSITVQWALHKA
KHATVSKVRVSIRRPGDQEAHAVELDSAADKYTFWDLLPGERYIIHVATLSGGTEDHPSE
SLATAPFHVWTRPLSPRNLTAARVTATSAHMVWDQPPPGTSVEGYIINVTTSQSVKSRYV
PNGKLTSYTMRDLQPGQRYRLSVTAVQNTEQGQMHSDPAHLHIVTSQRDGSSERRWSQGG
PPRVLRNRLPPSFLPDLRLLADREASEEPSQAPRFTELVDGRGRISAKFSSISAPSKSVT
VRSQPETPVRLENMEESTNRISLALQLPEAGKADKGPFPKNCSLNPCQNGGTCVGGPDSY
SCDCSQGFKGRHCELACKKVPHSCTRLYSETKSFPVWEGGICHYVYKRIYKVHPDICYKE
SCEGTTAKTPSRYQHRKRAPTAS
Download sequence
Identical sequences G3WCE5
ENSSHAP00000013100 ENSSHAP00000013100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]