SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013227 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013227
Domain Number 1 Region: 3813-4013
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-39
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 2 Region: 3330-3441
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-31
Family Cadherin 0.00057
Further Details:      
 
Domain Number 3 Region: 1128-1256
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-31
Family Cadherin 0.0016
Further Details:      
 
Domain Number 4 Region: 3224-3328
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-29
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 3120-3223
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-29
Family Cadherin 0.0005
Further Details:      
 
Domain Number 6 Region: 1557-1659
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-28
Family Cadherin 0.00088
Further Details:      
 
Domain Number 7 Region: 2804-2912
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 2272-2383
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 922-1025
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-26
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 3018-3126
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-26
Family Cadherin 0.00068
Further Details:      
 
Domain Number 11 Region: 1760-1880
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 12 Region: 1032-1133
Classification Level Classification E-value
Superfamily Cadherin-like 6e-25
Family Cadherin 0.00085
Further Details:      
 
Domain Number 13 Region: 817-920
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-25
Family Cadherin 0.00057
Further Details:      
 
Domain Number 14 Region: 138-260
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 15 Region: 722-815
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 16 Region: 2585-2720
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-23
Family Cadherin 0.0013
Further Details:      
 
Domain Number 17 Region: 1445-1553
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 18 Region: 2912-3016
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-23
Family Cadherin 0.00079
Further Details:      
 
Domain Number 19 Region: 2070-2177
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.0026
Further Details:      
 
Domain Number 20 Region: 458-559
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-22
Family Cadherin 0.00078
Further Details:      
 
Domain Number 21 Region: 3434-3538
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 22 Region: 2177-2284
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 23 Region: 1664-1766
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-21
Family Cadherin 0.0028
Further Details:      
 
Domain Number 24 Region: 2487-2597
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-19
Family Cadherin 0.0024
Further Details:      
 
Domain Number 25 Region: 2385-2493
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-19
Family Cadherin 0.0023
Further Details:      
 
Domain Number 26 Region: 1234-1354
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-17
Family Cadherin 0.0034
Further Details:      
 
Domain Number 27 Region: 1873-1971
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-17
Family Cadherin 0.0035
Further Details:      
 
Domain Number 28 Region: 1359-1457
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-16
Family Cadherin 0.0074
Further Details:      
 
Domain Number 29 Region: 563-664
Classification Level Classification E-value
Superfamily Cadherin-like 9.68e-16
Family Cadherin 0.0036
Further Details:      
 
Domain Number 30 Region: 1979-2082
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000443
Family Cadherin 0.0019
Further Details:      
 
Domain Number 31 Region: 2701-2810
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000885
Family Cadherin 0.0045
Further Details:      
 
Domain Number 32 Region: 4128-4167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000165
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 33 Region: 4093-4132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000776
Family EGF-type module 0.013
Further Details:      
 
Domain Number 34 Region: 367-454
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000814
Family Cadherin 0.0043
Further Details:      
 
Domain Number 35 Region: 34-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000942
Family Cadherin 0.007
Further Details:      
 
Domain Number 36 Region: 4054-4090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000042
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 37 Region: 3543-3632
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000471
Family Cadherin 0.0099
Further Details:      
 
Domain Number 38 Region: 272-353
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000443
Family Cadherin 0.0051
Further Details:      
 
Domain Number 39 Region: 4014-4057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000195
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013227   Gene: ENSSHAG00000011310   Transcript: ENSSHAT00000013336
Sequence length 4589
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864787.1:830587:987098:1 gene:ENSSHAG00000011310 transcript:ENSSHAT00000013336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRHLALLLHLLLLQHFGNVEGSQRTEQTLEMIQFTQFEYNVTVYENSAAKTYVGHPIKM
GIYLTNPSWELRYKIISGDNENLFKAEEHILGNFCFLRIRTKGGNTAILNREVKDHYTLT
VKAVEKNTNVEARTKIRVQVLDTNDLRPLFSPTSYSVSLPENTMIRTSIARVSATDADIG
TNGEFYYSFKERTDMFAIHPTSGVVVLTGRLDYAETKLYEMEILAVDRGMKLYGSSGISS
MARLSVHVEQANEYAPVITAVTLFPLEQEKDPTYAVVTVEDNDQGSNGEIASLSIVAGDP
LQQFRTVRSFPGSKEYKIKTVGNVDWESHPFGYNLTLQAKDKGNPPQFSSVKVIHLTSPR
FKAGPVQFEKDIYRAEISEFAPPHTPVVMVKAVPHYSHLKYILKTISGKGRFHINPNTGL
ITILEPVSTQQASHFELDVMTSDSKAYTKVLVKVMSTNSNPPEFTQTSYKTSFDENIPVG
TSVMSVSAIDSDEGENGYVTYSIANLNQVPFVINHFTGAVSTSEELDYELMPRVYTLRVR
ASDWGLPYRREVEALVTLTLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADEL
QLVRYQIEAGNEFDLFSLNPNSGVLSLKHSLTEGLGAKVSFHSLRITATDGENFATPLYI
NITVAASRKPVNLHCQETGVAKMLAEKLLQANKLHNRGELEDVFFDTHSINVHVPQFRSS
LPTSIEVKENYPVGSNIILMNATDLDSGFNGKLVYSISGGNDDSCFIIDLETGMLKVLSP
LDRETTEKYTLNITVYDLGIPQKAAWCLLDIRVLDANDNKPEFLQDNYFIEVSENRELNS
EIIQIEATDKDLGLNGEVKYYLLTDTDKFSIDSETGIVKVVGPLDREKQHVHFLKIEARD
QADMEPQLFSTVLLKVSLEDVNDNPPKFIPSNFLVKVREDLPEGTIIMWLEAYDPDFGQS
SQVRYSLIDNGDGNFDVDKLSGAIRIVQQLDFEKKQVYNLTIKARDKGKPISLSSTCYVE
VEIIDVNENLHPPLFSSFVDKALVKEDVPIGTSVMTVSAHDEDTGRDGEIHFSIRGGSGI
GIFKIDEEKGVIETAEKLDRETVSHYWLTVFATDQGVVPLSSFTEIYIEVEDVNDNAPQT
SEPVYYPEVMENSPKDVSVVQIEAFDPDSSSNDKLTYKITSGNPQGFFSIHPKTGLITTT
SRKLDREQQNEHILEVTVTDDGIPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPERDK
PERERSAKREPIYRVIATDKDEGPNAEISYSIEDGDEHGKFFIEPKTGVVSSKKFSGARE
YDILSIKAVDNGRPQKSSTARLHIEWISKPKPSPEPISFEEPYFSFTVMESDPVAHMIGV
ISVEPLGTSLWFDIIGGNYDSRFDVDKGTGTIIVARPLDAEQKSNYNLTVEATDGTTAII
TQVLIKVIDTNDHRPQFSKSKYEVLIPEDTVPDTEILQISATDKDEKNKLIYTLQSSTDP
LSLKKFRLDPATGSLYTTEKLDHETAHQHILTVMVRDQDVPVKRSFARVIVNVSDMNDHA
PWFTSSSYQGRVYESAAVGSVVLQVTALDKDKGENAEVLYSIESGNIGNSFTIDPILGSI
KTAKELDHSNQEEYDLMVKATDRGNPPMSEITSVHIFVTISDNAIPRFTSKEYSTEISEA
ASIGSFIGIISAHSQSSVVYEIKDGNIGDAFDINPNSGVIITQKTLDFETLPFYTLIVQA
TNMAGLSANTTVWVHLQDENDNVPVFMQAEYTGLISESASINSVVLTDKNVPLVIRAMDA
DKESNALLVYQIVEPSAHKYFAIDSSTGAIRTVLSLDYEEAHIFHFTVQVHDMGTPRLFA
EYAANVTIHVIDINDCPPVFSKMLYESSVLVPTYKGVKVITVNATDADSVAFSQLMYSIP
EGNIGEKFLIDPKTGTITVQNTTQLRSRYELTVRASDGKFTSHTSVKINVKESKESQLKF
TQNSYSAIVKENSTEARTIAVITAIGNQINKPLFYHILNPDNRFKISHTSGVISTTGIPF
DREQQEAFDVVVEVTEEHKPSVVAHVVVKVIIEDQNDNAPVFVNLPYYAVVKVDAEVGHI
IRCVTAVDRDIGRNGEVHYYLKEHHEHFQIGPSGEISLKKKFEPDTLNKEYLITIVAKDG
GDPAFSAEVIVPITVMNKAMPVFEKAFYSAEIPENIQLHSPVVHVQANSPEGLKVFYSIT
EGDPFSQFTINFNTGVINVIAPLDFESHPAYKLSIRATDSLTGVHAEVFVDIIVEDVNDN
PPVFAQQSYTTTLSEATVIGMSVVQVHATDSDSVPNRGISYHLFENQTKSPDHFHIDGSS
GLISLVRSLDYEEIQEHKLLVRAVDSGMPPLSSDMIVTVDVTDLNDNPPLFDQLLYEAKI
SEQAPHGHFVTCVKAYDADSSDIDKLEYSILSGNEHKNFAIDSKTGIITLSNLRRQTLKP
FYNMNVSVSDGVFRSSAHIEIIVIQANLHSPIFMQNEYEVELAENAPLQTLVFEVKATDE
DSGIYGQITYHIVNDFAKDRFYINERGQIFTSEKLDRETAGEKVIAIRLMAKDTGGKVAF
CTINVILTDDNDNAPQFRATKYKVTIGSDAPKGTSVIKVLASDADEGSNADIMYSIEADS
ESVQENLEINKLFGIITTKESLVGLENEIFTFFVRAVDGGSPSKESVVPVYVKILPPETP
LPKFSEPFYTYTVSEDLPIGTEIDVIRVDYSEPVLYSLTKGNTPESNGGEVFVIDKHSGK
LKLEKNLDHETMKWYQFSVVAQSTHEDSEVVSSVDISIQVKDANDNSPILESNPYEAFIV
ENLPGGSKVIQVKATDLDSGTNGQILYSLDQSQSLDVIESFAIDMETGWITTLKELDHEK
RDKYHITVIASDYGEKVQLSSTAVVEISVTDVNDNPPRFTAEIYKGTVSEDDPPGGVIAI
LSTTDADTEEINRQVTYYITGGDPLGQFAVENIQNEWKVYVKKPLDREKKDNYLLTITAT
DGTFSSKAIVEVKVLDANDNSPICEKSAYSDTIPEDTVPGKLIMQVSATDADIRSNAEIT
YTLSGPGAEKFKLNADTGELKTFAPLDREQQAVYNLLVKATDGGGRFCQMSVVFTLEDVN
DNAPEFSADPYAITVFENTEPKTPLTRVQATDADAGLNHKIAYSLVNSADGQFSIDESSG
IIRLEKPLDRELQAVYNLILKAVDHGVPRRLTATGTVIVSVLDINDNPPVFEYREYGATV
PEDILVGTEVLQVYAASRDIEVNAEITYAIISGNEHGKFSIDSTTGAIFIIDNLDYESSH
EYYLTVEATDGGTPSLNDVAAVNINVTDINDNTPVFSQDTYTAVISEDAVLEQSVVTVMA
DDADGPSNNYIHYSIIDGNQGNPFTIDPVKGEIKVTQLLDREMISGYTLTVQAADNGSPP
RVNTTTVNIDVSDVNDNPPVFSKGNYSIIIQENKPVGVSVLQLVVTDKDSSHNGPPFFFS
IMSGNEEKAFEVNQEGVLITSMAIKRKVKDHYFLHVKVADSGKPQLSSLAYIDIRVIEES
IYPPAILPLEIFITTFGEEYSGGVIGKIHATDQDVYDTLTYNLDPKMNNLFSVSNTGGKL
VAHKKLDMGQYLLNVSVTDGKFTTMADIMVHIRQVTQEMLNHTIAIRFANLTPEEFVGDY
WRNFQRALRNILGVRRNDIQVVSLQPSEPQSNLEVLLLVEKSGNTHVSMKVLLQKINSSV
ADIEEIIGVRILEVFHKLCAGLDCPSKFCDEKVTLDDNVMSTHSTARLSFVTPRHHRAAL
CLCREGKCPLVDHECESNPCPEGTECITDPEGGKYTCVCPGGKFGQCPVGSSVTFTGNSF
VKYRLMENESKLEMKLTMRLRTYSTHAVVMYARGTDYSILEIHNGRLQYKFDCGSGPGIV
SVQSIQINDGQWHSVSLEVNGNYARLVLDRVHTASGTAPGTLKTLNLDNHVFFGGHIRQQ
DSRPGRSPQINNGFRGCMDSIYLNGQELPLTSKPRSYAHIEEYVDVSPGCLLMAIEDCSS
SPCQNGGICNPSPSGGYYCKCSALYMGTHCDISVNPCASNPCLYGGTCIRDNGDFICQCR
GLYTGQRCQLSPYCKDEPCKNGGTCFDSLDGAICQCEAGFHGERCQSDIDECAINPCRNG
ALCENTHGSYRCNCSHEYRGKHCEDSLPNKYVSTPWNIGLAEGIGIIVFIVGIFLLVVIF
VICRKMIRKKKKHQGEPEDKHLGPTTAFLQRPYFDSKLNKSIYSDVPPQVPVRPISYTPS
IPSDSRNNLDRNSFEGSAIPEHPEFSTFNPDSMHGHRKAVAVCSVAPNLPPPPPSNSPSD
SDSIQKPNWDFDYDSKVVELEPCISKKPLEEKVSHPYSARESLSEVQSLSSFQSESCDDN
GYHWDTSDWMPNVPLPDIQEFPNYEVIDEQTPLYTDPSAIDTDYYPGGYDIESDFPPPPE
DFPAPDELPPLPPEFSDQFESIQPPKDMPATVRSLGSSTKSRQRFNFNQFLPNFYPIDMS
EPQKTMNGENSNCREPFAPYPSGYNRDFETPTVDNISMSVYASTASCSDVSACCEMESEV
MMSDYESGEDGHFEDVTIPPLDTQQHTEV
Download sequence
Identical sequences G3WCS2
XP_003773048.1.9362 ENSSHAP00000013227 ENSSHAP00000013227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]