SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013578 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013578
Domain Number 1 Region: 288-604
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-85
Family Protein kinases, catalytic subunit 0.0000016
Further Details:      
 
Domain Number 2 Region: 103-203
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 6.28e-44
Family MAST3 pre-PK domain-like 0.0000126
Further Details:      
 
Domain Number 3 Region: 873-965
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-20
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013578   Gene: ENSSHAG00000011607   Transcript: ENSSHAT00000013690
Sequence length 1268
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841172.1:877659:971445:1 gene:ENSSHAG00000011607 transcript:ENSSHAT00000013690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTDGRRWSLASLPSSGYGTNTPSSTVSSSCSSQEKLHQLPYQPTPDELHFLSKHFCTESI
ATENRCRNTPMRPRSRSLSPGRSPACCDHEIIMMNHVYKERFPKATAQMEERLQEIITNY
SPDNVLPLADGVLSFTHHQIIELARDCLDKSHQGLITSRYFLELQHKLDKLLQEAHDRSE
SGELAFIKQLVRKILIVIARPARLLECLEFDPEEFYYLLEAAEGHAKEGQGIKTDIPRYI
ISQLGLNKDPLEEMAQLGSYDSGTAETPETDESSSNTSLKLRRKPRESDFETIKLISNGA
YGAVYFVRHKESRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMYCSFETR
RHLCMVMEYVEGGDCATLMKNMGPLPVDMARMYFAETVLALEYLHNYGIVHRDLKPDNLL
VTSMGHIKLTDFGLSKVGLMSMTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGY
GKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVISDEINWPEKDEAPPPDAQDLITLL
LRQNPLERLGTGGAYEVKQHQFFRSLDWNSLLRQKAEFIPQLESEDDTSYFDTRSEKYHH
METEEEDDTNDEDFNLEIRQFSSCSHRFSKVRKSLEKSLVPEEKNPCCCVSNSWGREGER
EMIKKREWSLGHINLLSESYLFFSSQSIHFSASDKLAISTEGEQSEPTVCARESREEPEK
PALPSEENAQDEPEVTTPASTISSSTLSGERRGPNYEENKENMSSYGNTEHLDQINGRSE
CVDSTDNSSKPSSEPASQMARQRLESTEKKKISGKVTKSLSASALSLMIPGADMFGVSPL
GSPMSPHSLSSDPSSSRDSSPSRDSSAASASPHQPIVIHSSGKKFGFTIRAIRVYVGDSD
IYTVHHIVWNVEEGSPAYQAGLKAGDLITHINGEPVHGLVHTEVIELLLKSGNKVSITTT
PFENTSIKTGPARRNSYKSRMVRRSKKTKKKESLERKGRRSLFKKLAKQPSPLLHTSRSF
SCLNRSLSSGESLPGSPTHSLSPRSPTPSYRSTPDFPSGTNSSQSSSPSSSAPNSPAGSG
HIRPSTLHGLAPKLGGQRYRSGRRKSAGSIPLSPLARTPSPTPQPPSPQRSPSPLLGHSL
GNSKIVQAFPSKMHSPPTIVRHIVRPKSAEPPRSPLLKRVQSEEKLSPSYSSDKKHLCSR
KHSLEVTQEEVQREQSQRDSTLQSLEENVCDAPSLTRARPVEQGCLKRPISRKLGRQESV
DELDRDKL
Download sequence
Identical sequences G3WDS3
ENSSHAP00000013578 ENSSHAP00000013578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]