SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013648 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013648
Domain Number 1 Region: 779-797,853-985
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.88e-17
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 2 Region: 38-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000233
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 3 Region: 114-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000553
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 4 Region: 76-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000107
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 288-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000228
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 1013-1054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000369
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 7 Region: 192-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000046
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 8 Region: 152-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000141
Family EGF-type module 0.007
Further Details:      
 
Domain Number 9 Region: 602-746
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000187
Family Laminin G-like module 0.04
Further Details:      
 
Domain Number 10 Region: 1129-1166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000213
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 3-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000913
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 1048-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000697
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 230-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000129
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 1092-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000179
Family EGF-type module 0.019
Further Details:      
 
Domain Number 15 Region: 775-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000635
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013648   Gene: ENSSHAG00000011663   Transcript: ENSSHAT00000013760
Sequence length 1241
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834637.1:885792:909881:1 gene:ENSSHAG00000011663 transcript:ENSSHAT00000013760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGSCAVQPCHHGGTCLAAGAGSACLCLPGWTGPLCEEDVDECKSGPCQNGALCVNDPGGF
LCYCVPGFQGPHCELDINECASRPCKHEASCINRVDGYQCLCSPGYTGLNCETEIDECES
DPCQNGGSCLDGIGTYQCLCSPGFTGHNCQVDIDECESQPCANGGICQNFINRFQCDCGG
TGFEGALCEVEVLECLSSPFLHIATCLEGLGNYTCVCLPGYHGEHCEMDEDDCAGDPCLH
GGLCLQRSNQSLYGGAQPVFPGTFSYSSAAGFVCQCLPGFAGDNCSVDVNECESHPCQNG
GTCEDLPNSFQCHCLAGYTGEDCGQFSSLCLSLPFPPFSEFSLCMCCPSEMLECVSLNEA
ERRELSLSLCGIPAMCMLAHILGYTHLGVHTPSPSTGMPFSPLRHPPPSPVQIPPSASLS
LAQAWAQLFHPVITQAGSLDRGKAFSSSWNFQAPETFQFSRSMSFLMLNVSELLPLGGAT
GHRVICEVIGLQMLKLYLLLSSCPGLQLLDLAGPTAQCPTQTDPDLPGPHVCKGDEMTSL
LPGAVLGGLLLLAVRGGRLVFMVFIRKTRCLPMIPQTRSCLSWAELCCCRDRRLGRTEGP
SSVTYSGLGTALKARLWTLGLVMGRHLSTLLIRLNSSEHEQLINSFSNSSPGNITRAISA
GELRVEVAAAAQVVALPGRLDDGHKHLVTLGLGRGQLQGPPLGPSYEVYVGGLASAAWAQ
PWGGNFKGCLQDIRLNSLRLDLLPLLQPDNRTGSGGALEGRASNLTLGCVSEDTCRFDPC
HNGGTCTVTWNDFICSCPHNFTGPTCAKRLWCQAQPCPPSTTCAEVPDGYVCLANATFQD
QPPAVFTSHNMSAQRELVALSLAFRTRDLEAVLLQAAGEGASLRVAIHNGSLSVSVRSGN
SVEGATFGGVAPVSDGAWHLVSLAMEEPAASLSRWQLRLDEAQNVTLWGQAGTLDFLRHH
VRVVLAENFTGCLGRVTVGGLDLPFARLPTPLPQPEQFLLEGGGVDLGCRGHPVCSAEPC
LHGGTCQDLFDAFSCACGASWNGPRCEVDVDECGSAPCVHGRCRNLPGSYYSCRCPPEFF
GPRCQWPFPPEECGRNFTCLNGGHCSDGPWGANCSCPMGFTGLRCQIRIPECEPNPCQNG
GTCQAAGSEVECICSSNFGGRHCDVAKGPPVTLFSFPLIEVVVPVACGCLLLLLIGLLSG
VLAARKRRQSEGTYSPSQQEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences G3WDZ3
ENSSHAP00000013648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]