SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013652 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013652
Domain Number 1 Region: 283-339
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000271
Family VPS37 C-terminal domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 22-90
Classification Level Classification E-value
Superfamily UBC-like 0.000000275
Family UBC-related 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013652   Gene: ENSSHAG00000011666   Transcript: ENSSHAT00000013764
Sequence length 355
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864737.1:886366:909046:-1 gene:ENSSHAG00000011666 transcript:ENSSHAT00000013764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSIAEIQKDVEYRLPFTVNNLTININIFLPPQFPQEKPVISVYPPIRHHLMDKHGVYVTC
PLVNNFTMHSDLGKIVQSLLDEFWKNPPVLAPSSPFAYLYGGPAGMPPYAAQGFPFLPSY
SPQEANRPMASVPVPDTVSPASSYSTPKPAAPSYSFLSSLPLPVPTIDAPLLTGQNGCGY
KMPDIPDTFPELSELSLSQLTDMNEHEEAFLEQFSTLPQLKQVITDKDDLVKSIEDLARK
NLLLEPSLEAKRQTVLEKYELLTQMKSGFEKKMQRQHELSESCSASALQARLKVAAHEAE
EESDTLAEDFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQAIATHTQFHAPL
Download sequence
Identical sequences G3WDZ7
ENSSHAP00000013652 ENSSHAP00000013652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]