SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013720 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013720
Domain Number 1 Region: 180-359
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.63e-44
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00052
Further Details:      
 
Domain Number 2 Region: 1-165
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.74e-23
Family Crotonase-like 0.0021
Further Details:      
 
Domain Number 3 Region: 361-514
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 4.25e-22
Family HCDH C-domain-like 0.0015
Further Details:      
 
Domain Number 4 Region: 498-588
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 7.57e-19
Family HCDH C-domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013720   Gene: ENSSHAG00000011731   Transcript: ENSSHAT00000013833
Sequence length 606
Comment pep:known_by_projection scaffold:DEVIL7.0:GL857020.1:897224:909490:-1 gene:ENSSHAG00000011731 transcript:ENSSHAT00000013833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQVGLPEVTIGLLPGAQGTQLLPRLIGVPAALDLITSGRHILASEALKLGILDKIVNADP
VEEAIKLAKSVSGQSISSRRLIMRQVQNLPNMDIIFQETLLRMRKQYPGCISREACVQAV
QAAVQYPYLEGKEREKELFLYLVTSGQARALQYAFFAERIVRKWSTPSGASWKTSSGKPI
SSAAVVGLGTMGRGIVISLIMAGIPVIAMEQDEQQLDGAKRMIFFVLEQEASKRKGSGQE
WRQPRLRFTTSLDEVAGTDLVIEAVFEEMGLKKQVFGSLSARCQPSALLCTNTSCLDVDE
LALCTGRPHQVIGTHFFAPAHRMKLLEVIPSRYSSPTTIATVMGLAKTLQKVGVVVGNCL
GFVGNRMLMAFNEQNYFLLEDGSRPEEIDQVLEEFGFRMGPFRVADLSGLDVGWKSRKGQ
GLTGPLVAPGTPLRQRGGRRYCPIPDILCEHGRLGQKTGRGWYQYDKPTGWRHQPDPWLS
KFLSEYRREHEIEPRAITSEEILERCVYSLINEGFRLLEEGMAAGPEHIDVIYNNGYGWP
RHRGGPMFYASTVGLPTVAERLQKYYQKNLDVPKLEPCNLLKKLASQGNPPLQEWRRLGR
LQTSHL
Download sequence
Identical sequences G3WE65
ENSSHAP00000013720 ENSSHAP00000013720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]