SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013726 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013726
Domain Number 1 Region: 572-674
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000592
Further Details:      
 
Domain Number 2 Region: 137-245
Classification Level Classification E-value
Superfamily SRCR-like 1.27e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000592
Further Details:      
 
Domain Number 3 Region: 1-103
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000805
Further Details:      
 
Domain Number 4 Region: 296-405
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-34
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 5 Region: 698-801
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-33
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 6 Region: 436-546
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-31
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013726   Gene: ENSSHAG00000011736   Transcript: ENSSHAT00000013839
Sequence length 1079
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834457.1:898581:941401:-1 gene:ENSSHAG00000011736 transcript:ENSSHAT00000013839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLVSNHSRCEGRVEIYRDKKWGTICDDDWDLNDAQVVCRQLDCGRAISSPGNAYFGEGS
GPIAMDDVQCTGNEYHLWECNHRGWFSHNCNHYEDAGVICSGNSISLFSPEKSFRQERTF
PGSCGTTQYLIIYVFVSDTTTLRLVASSNRCEGRVEIYHDGQWGMVCDDGWDLQDAQVVC
RQLGCGGAISAPGNAYFGQGSGPISLYDVQCTGNEDNLRDCSHRDWLSHNCTHLNDAGVI
CSNIMTKLPSYINLNNTRLPYKKRTWDNLKNYSKSLHTFSFLAVPKSSTTRDSKTSCGGS
LVASSGSFTSPNYPGYYPNLLNCIWEIEVDNDFQITLVFDDLQLEFEDSCIYDYIEIFDG
SLYASSFGRFCKGPIRTLISNSNRITILFKTDGSITNRGFSASYTKSPKGNTSTNTEIST
PFPPFTTTPFTTPDPSMDCGGFLFDPEGSLSSPFYPGQYPNNAHCVWQIEVDPDSLINLI
FDDVELEGCHFDYIDIIDGSPNGSLMERICAGSQHTIASLTNKMTVIFTSDHSIQKRGFR
ARYETFPRGKSLVHLFIIKIAIISLSFLAGILRLVASSNRCEGRVEIYHDGQWGTVCDDD
WDLQDAQVVCRQLGCGTAISAPGNAYFGQGTGPISLDDVQCVGNEYQLTDCFHRNWFSHN
CGHYEDASVICSNINISPSPNVIKTSARIDNCGGYLDAFGGSFTSPNYPKPHPEFAYCVW
HIQVDKGYKINLNFKEIFLEIDDNCRFDFVAVYDGPSTNSGLLAQVCGRIAPTFQSSSNT
LTVALSTDYANSYRGFSASYTPIYEKEVNTSLSCSSDQMTVIISKSYLESLHYNENNLQL
NDPLCRPRVSNVLEFSIPLNECGTIKQVKDHTITHTNIITITNSSNSAVITRQKHFQIIL
KCEMENNSTVEIMYITEDDIIKNITALGKYNISMAFYESESFSNPLLSSPYYVDLNQTLF
VQVSLHVLDPNLVVFLDTCTASPTSDLAPPTYDLINSGCSKDDTCKIYPLSGHYGRFQFS
AFKFLRRLGSVYLQCKVLICESNDTQSRCNQGCVSRRRRDISSYKWKTESIIGPIRLKT
Download sequence
Identical sequences G3WE71
ENSSHAP00000013726 ENSSHAP00000013726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]