SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013900 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013900
Domain Number 1 Region: 88-234
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-34
Family Pleckstrin-homology domain (PH domain) 0.0006
Further Details:      
 
Domain Number 2 Region: 349-479
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.45e-31
Family DEP domain 0.0012
Further Details:      
 
Domain Number 3 Region: 251-365
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-28
Family DEP domain 0.003
Further Details:      
 
Domain Number 4 Region: 4-102
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-27
Family DBL homology domain (DH-domain) 0.00035
Further Details:      
 
Domain Number 5 Region: 459-546
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000158
Family PDZ domain 0.036
Further Details:      
 
Domain Number 6 Region: 551-612
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000381
Family PDZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013900   Gene: ENSSHAG00000011889   Transcript: ENSSHAT00000014017
Sequence length 1505
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834670.1:922833:1033846:1 gene:ENSSHAG00000011889 transcript:ENSSHAT00000014017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELNKIPAIRAFLLSCMLLGGRKTTDIPLEGYLLTPIQRICKYPLLLKELAKRTPGKHPD
HPAVQSALQAMKTVCTNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLL
KISAGNIQERAFFLFDNLLVYCKRKSRVTGGKKSTKRTKSINGSLYIFRGRINTEVMEVE
NVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCMAKTAEDKQKWLDAIIKEREQRESLKL
GMERDAYVMIAEKGEKLYHMMMSKKVNLIKDRRRKLSTVPKCFLGNEFVSWLIEIGEISK
TEEGVNLGQALLENGIIHHVSDKHQFKNEQVMYRFRYDDGTYKPRSELEDIMSKGVRLYC
RLHSLFIPVIKDRDYHLKTYKSVIPGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHH
VLEKSEFKDESQYFRFHADEEMEGTSSKNKLLRNDFKLVENILARSLLILPQEDDYGFDI
EEKNKVIMVKSVQRGSLAEMAGLQVGRKIYSINEDLVFLRPFSEVEAILNQSFCSRRPLR
LLVASKAKEIIKVPDHPETLCFQIRGASPPYVHAVGRGSEAAAVGLNAGQCILKVNGNNV
TNESFTEVLDHFLAYRSRQQEALGLYQWIYRTHEDAEEARAQHWGPGGYLNGSLDEAGEH
GPLGGRQDDEDFSFQSMGPQLPIPEGSPVISLTVENVHLEHGVVYEYVSTAGIKCFVLEK
IVEPKGCFALTAKILEAFAADDSLFVQNCGRLISQSSAVVTMPQYEFRNICETKLERITR
RIANYQEYAGQLRGRVSPAFKQAPLEPHALCSLDFCPTNCHVNLMEVSYPKNTTSVGRSF
SIRFGRKPSLIGLDPEQGHINPMSYTQHCITTMAAPSWKCLSQEDGESLDSQSTVNQQNG
GPGQEDRGLSFLLKQEDREIQDAYLQLFNKLDVAVKEMKQYVMQINKLLSTITEPMGDGS
CEPPSTEEVSASPLVSEDSEIDKADHSGIKKVCFKVSEEDQEDSGHDTMSYRDSYSECNS
NRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINAL
LKGSVMSKAFEETKHFPMEHSLQDFKQKEECPIRGRSMIQISIQEDPWNLPNSIKSLVDN
IQKYVEDGKNQVLLALLKCTDTELQLRRDVIFCQSLVAAICAFSDQLLAALSYRYNNNGE
YEESSRDASRKWLEQIAATGVLLHFQSLLSPGLREERIMLEDIRVTLPELDNVTFSFKQL
DENFVTNTHVFYHIEGCRQGLKVVFYLDSYHFSKLPTRLENGGSLKLHTVLFTKALENLE
GQPQAGGSPTSLLEELQQEINAQSLEKVQQYYRRLRTFYLERSNLPTDASATAVKIDQLI
RPINAMDELCRLMKSFVHSKPGTSVPGAGLLPISSELCYRLGACQVTMCGTGMQRSTLSV
SLEQAAILARSHGLLPKCIMQATDIMRKQGPRVEIMAKNLRIKDQMPQGAPRIYRLCQPP
VDGDL
Download sequence
Identical sequences G3WEP5
ENSSHAP00000013900 ENSSHAP00000013900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]