SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013945 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013945
Domain Number 1 Region: 253-320
Classification Level Classification E-value
Superfamily XPC-binding domain 2.22e-24
Family XPC-binding domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 1-68
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000253
Family Ubiquitin-related 0.0000603
Further Details:      
 
Domain Number 3 Region: 154-210
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000559
Family UBA domain 0.00064
Further Details:      
 
Domain Number 4 Region: 336-387
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000161
Family UBA domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013945   Gene: ENSSHAG00000011925   Transcript: ENSSHAT00000014062
Sequence length 389
Comment pep:novel scaffold:DEVIL7.0:GL841572.1:928013:975571:1 gene:ENSSHAG00000011925 transcript:ENSSHAT00000014062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAAAT
STPSPATTQQSNPATTTTVSSSSAASVAQAPTPSPALAPTPTPTSVTPTPAAAACEPIPT
STPKEEKPAEKPVEAPVGISPTSSDSTLGDSSRSNLFEDATSALVTGQSYENMVTEIMSM
GYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAAQSSAVAAAAA
TTTATTTTTTTSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQ
HQEHFIQMLNEPVQESGGQGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPE
GLVIQAYFACEKNENLAANFLLQQNFDED
Download sequence
Identical sequences G3WEU0
ENSSHAP00000013945 ENSSHAP00000013945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]