SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014217 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014217
Domain Number 1 Region: 334-470
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-31
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 2603-2785
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-30
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 3 Region: 2011-2116
Classification Level Classification E-value
Superfamily Cadherin-like 3e-29
Family Cadherin 0.00075
Further Details:      
 
Domain Number 4 Region: 1907-2018
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 2117-2228
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-29
Family Cadherin 0.00045
Further Details:      
 
Domain Number 6 Region: 1057-1170
Classification Level Classification E-value
Superfamily Cadherin-like 9.55e-29
Family Cadherin 0.00095
Further Details:      
 
Domain Number 7 Region: 1588-1696
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 8 Region: 543-663
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 9 Region: 1368-1505
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-23
Family Cadherin 0.0038
Further Details:      
 
Domain Number 10 Region: 234-338
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.00066
Further Details:      
 
Domain Number 11 Region: 1811-1913
Classification Level Classification E-value
Superfamily Cadherin-like 3e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 12 Region: 446-549
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 13 Region: 1270-1380
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-21
Family Cadherin 0.0034
Further Details:      
 
Domain Number 14 Region: 651-775
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 15 Region: 852-959
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 16 Region: 2216-2332
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 17 Region: 22-137
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 18 Region: 1168-1267
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-19
Family Cadherin 0.0014
Further Details:      
 
Domain Number 19 Region: 960-1067
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-19
Family Cadherin 0.0015
Further Details:      
 
Domain Number 20 Region: 1697-1802
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 21 Region: 760-864
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000003
Family Cadherin 0.003
Further Details:      
 
Domain Number 22 Region: 141-240
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000995
Family Cadherin 0.016
Further Details:      
 
Domain Number 23 Region: 1486-1594
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000004
Family Cadherin 0.0041
Further Details:      
 
Domain Number 24 Region: 2330-2419
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000117
Family Cadherin 0.0044
Further Details:      
 
Domain Number 25 Region: 2881-2918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000944
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 26 Region: 2806-2844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000986
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 27 Region: 2843-2886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014217   Gene: ENSSHAG00000012153   Transcript: ENSSHAT00000014335
Sequence length 3373
Comment pep:novel scaffold:DEVIL7.0:GL849681.1:978852:1102629:-1 gene:ENSSHAG00000012153 transcript:ENSSHAT00000014335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQVTVTDGGSSPKQSTVWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFA
FDKDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTAGSYDILTIKAVDNGRPQKS
STARLHIEWIKKPPPSPVPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANIPLWFDVVGG
NFDSSFDTEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTNVAVTQVFIKVLDNNDNGPEF
SQSSYDVTISEDVLPDTEILQVEATDRDEKHKLSYTIHSSIDSVSMRKFRIDASTGVLYI
AERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTSPLYEASVFESAA
LGSAVLQVTALDKDRGENAELLYSIEAGNTGNTFKIEPILGIITVSKEPDMTTMGQFVLS
IKVTDQGTPPMSATAIVRISVTMSDNSHPKFTQKEYQAEVNENVDIGTSVILISAISQST
LIYELKDGNVEGAFTINPYSGVITNQKALDYERISSYQLIVQATNMAGMASNATVNIQIV
DENDNPPIFLFSHYSGSLSEVAPINSIVRSSGNNPLVIRATDADSNQNALLVYQIVESTA
KKFFTVDSSTGAIRTIASLDHETIAHFHFHVHVRDSGNPQLTAESPAEVNIEVTDVNDNP
PVFTQAVFETVLLLPTYVGVEILKVQATDPDSEVPAELTYSLMEGSVDYFLIDSSSGVLS
IKNSSLSKDHYMLIVRVSDGKFYGTAMVTIMVKEAMDSGLHFTQSFYFASISENSTNITK
VAIVNAIGNRLNEPLIYRILNPGNKFKIKSTSGVIQTTGVPFDREEQELYDLVVEASREL
DHLRVARVVVRVIIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYRVSALDRDKGANGEVT
YSLQEDYGHFEINPESGSVFLKEAFNSDLSNIEYGVIILAKDGGKPALSASIELPITIVN
KAMPVFDKPFYTTSVNEDIEMHTPILSINATSPEGQGIIYIIVDGDPYNQFNIDFDTGVL
NVISPLDYEETPVFKLTVRASDALTGARAEVTVDLLINDVNDNPPIFNQPAYNATLSEAS
LIGTPVLQVVASDADSENNKVVQYQIVQDTYNSTDYFHIDSTSGLILTARMLDHESVQQS
TLKVRATDNGFPPMSSEVLVNIYVTDMNDNPPIFNQLIYESYVSELAPRGHFVTCVQASD
ADSSDFDRLEYSILSGNDRTSFLMDSKSGIITLSNHRKQRMEPLYSLNVSVSDGLFTSTA
QVHIRILGANLYSPAFSQSTYVAEVRENAAPGTKVIHVRATDGDPGAYGQISYTIINDFA
KDRFLIDSNGQVITTERLDRESPMEGDISIFLRALDGGGRTTFCTVRVIVVDENDNAPQF
LTVEYRASVRADVGRGHLVTQVQAIDPDDGVNSRITYSLYSEASVSVADLLEIDPDNGWM
VTKSNFHQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPEILLPSFTQPQYSFSIPED
TVIGSTVDSLRILPSQNVVFSTVNGERPENNKGGVFIIEQDTGIIKLDKRLDREMIPAFY
FKVAATIPLDKVDIVFTVDIEIKVLDLNDNKPFFDASSYEAIIMEGMPIGTRLIQVKAID
RDWGANGQVTYALHSDSSPEKIMEVFSIDSNTGWISTLKDLDHERDPTFAFSVVASDLGE
AFSLSSTILVSVTVTDINDNAPVFGHEMYREQVKESDPPGEVVAVLSTWDEDTSDINQQV
SYHITGGNPRGRFALGLVQNEWKVYVKRPLDREEQDVYFLNITQLDGAVIVIEAAAAAVV
VVIEWVYPKCFPEVAYTALFPEDIPSNKIILKISAKDADIGPNGDIRYSLYGSGNNKFFL
DPESGELKTLALLDREKIPVYNLVARATDGGGRFCQSDIRLILEDVNDNPPIFSSDHYNA
CVYENTATKALLTRVQATDPDLGINRKVVYSLADSAGGYFSVDSSSGIIILEQPLDRELQ
SSYNISVKASDQSILKALSSLATVTITVLDINDNPPVFERRDYLVTVPEDTSPGTEVLAV
FATSKDIGTNAEITYLIRSGNERGKFMINPKTGGISVIDSLDYEMCKDFYLVVEAKDGGT
PALSAVATVNINLTDVNDNAPKFNQEVYSAVISEDASIGDSVIVLIAEDVDSPPNGQIRF
SIVSGDRDNEFAVDSVLGLIKVKKKLDRERVSGYSLLIQATDSGIPAMSSTVTVNIDISD
VNDNGPVFTPANYTAVIQENKPVGTSILQLMVTDRDSFHNGPPFTFTILAGNEEEEFVLD
PHGILRSAVIFRHTDSPEYVLYIQAKDSGKPQQVSHSYVHIRVIEESIHKPTAIPLEIFI
VTMEDDFPGGVIGKIHATDQDVYDVLTYALKSEQRSLFKVNTHDGKIIALGGLDSGKYIL
NVSVSDGRFQVPIDVIVHVEQLVQEMLQNTVTIRFENVSPEDFVGLHMHGFRRTLRNAVL
SQKQDSLHIISIQPVAGTNQLDMLFAVQMHSGSFYKPAYLIQKLSNARRHLENVIRISAI
LEKNCSGLDCQEQHCEQSLSIDSHSLMTYSTARISFVCPRFYRNVRCTCNGGLCPGSNDP
CMEKPCPGDMQCVGYEASRRPFICQCPPGKLGECSGHTSLSFAGNSYIKYRLSENSKKEE
FKLALRLRTLQSNGIIMYTRANPCIILKIVDSKLWFQLDCGTGPGILGISGRAVNDGSWH
HSVFLELNQNFTSLSLDDSYVERRKAPLYFQTPGAESALYFGALVQVDSVRSLTEKRVTQ
VLSGFQGCLDSVVLNDHELPLQNKRSSFAEVVGLTELKLGCVLYPDACERNPCQNGGSCA
SLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNTFICNCKVGLTGVTCEE
DINECDREECENGGSCVNVFGSFLCNCTPGYVGQYCGLRPVVVPNIQAGHSYVGKEELIG
IAVVLFVIFVLIVLFIIFRKKVFRKNYSRNNITLVQDPATAALLNKSNGIQFKNLRGGGD
SRNIYQEVGPPQVPVRPMAYTPCFQSDSRNNLDKIVDGLGVEHQEMTTFHPESPRILTAR
RGVVVCSVAPNLPAVSPCRSDCDSIRKSVWDAGTENKGVDDAEEVTCFVGSNKGSNSEVQ
SLSSFQSDSGDDNASIVTVIQLVNNVVDTIENEVSVMDQGQNYNRAYHWDTSDWMPGARL
SDIEEVPNYENTDGTSVHQGSTRELESDYYLGGYDIDSEYPPPHEEEEFLSQDQLPPPLP
EDYPDHFEALPPSQPASLAGTLSPDCRRRPQFHPSQYLPPHPFPNETDMVGPPPAHEFST
FAVGVGQNLENPSTADNVSLTLHNSLGTSSSDMSAGCGFEDSEVAMSDYESVEELSLTSL
HIPFIETQHQTQV
Download sequence
Identical sequences G3WFL2
ENSSHAP00000014217 ENSSHAP00000014217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]