SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014301 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014301
Domain Number 1 Region: 400-507
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-25
Family PDZ domain 0.0033
Further Details:      
 
Domain Number 2 Region: 5-100
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-22
Family PDZ domain 0.0000856
Further Details:      
 
Domain Number 3 Region: 158-260
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-19
Family PDZ domain 0.025
Further Details:      
 
Domain Number 4 Region: 680-790
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000186
Family Nucleotide and nucleoside kinases 0.0011
Further Details:      
 
Domain Number 5 Region: 508-584
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000604
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014301   Gene: ENSSHAG00000012218   Transcript: ENSSHAT00000014420
Sequence length 1763
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834482.1:990348:1061297:1 gene:ENSSHAG00000012218 transcript:ENSSHAT00000014420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQEN
DRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVTRPDPEPVSENEEDSY
DEDVHDSRGTRSGPVVGRRSEKSWVRDRSASRERSLSPRSDRRSVASSQPAKPTKVTLVK
SRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIER
SKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSNRSHDRPRRSR
SRSPDQRSEPSDHSRHSPQQPSNGSLRSREEEKNSKPGAVSTPVKSIDDLMPTKTIEEAV
VERNEKQPPALPEPKPVYAQVGQPDVDLPVSPSDGLLPSSTHEDGMLRPSMKLVKFRKGD
SVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLP
KGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYN
GKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSK
RNLRKSREDLSAQPFQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQV
AKSEPRDAGTDQRSSGIIRLHTIKQIIDRDKHALLDVTPNAVDRLNYAQWYPIVVFLNPD
SKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQ
QQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGG
AYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHESQTYPSYSPQAQPQPIHRID
SPGFKTASQQKAEVSSAVPYPSSETHPASTSAVNPNVNLTNIQLEEPVPAPYNSYQPQAG
PLTPPSTETSQIVLRDQEPSLSSHVDPAKVYKKEQYIEEPSRQNYVMKQLPVNHPVQRQE
KESNLSYEPQPPYAEKQSSRDIEPPAFKYESTNYADQLSRSYDPRLHYDDHRTPSYEDQW
SYYDDKQPYQTRPSFDNQHPRDFDSRQHSDETSERPYFPVQPRFEEPTPVSYDNRSRYEQ
PPKNSNLRYEEQPTSGYDIHGRYKSEAQPYSSAMSKSSEAKQYFDQYSRSYEQVPPQGFN
AKVGHYEPSSHGSTGVPSLIPSSQKTEVLSSNTKPLPPPPTIIEDEEDPAMKPQSVLTRV
KMFENKRSASLESKKDINDTATVIKPPEIAPKPAVAPISGPKSTSQNQFSDHDKTLYRSP
EPQKPQVKAPEDIVRSNHYDPEEDEEYYRKQLSYFDRRNFENKPSAQVPAGHLVESVKPI
HSSNQLGFSNYSNRGKPIETDIMDRSFGEKRYESTQVTPPPPPPPSQYSQPSQPITNSSL
SHHTHPKGHLSEGNSLSLDFQNSLVSKPDPPPSQNKPLTFRSSNREDTVQSTFYPQKSFP
DKGPVNGTEQTQKTVIPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPNETHHKLELST
KAPNSPKTFLKAHSSSQPPEFDSGVETFSIQTDRPKYQPNNISAVPKAIPVSPSALEDDE
DEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILPPL
DKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQN
KSLPGDPNYLVGANCVSVLIDHF
Download sequence
Identical sequences G3WFU6
ENSSHAP00000014301 ENSSHAP00000014301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]