SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014341 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014341
Domain Number 1 Region: 120-234
Classification Level Classification E-value
Superfamily ARID-like 4.58e-33
Family ARID domain 0.000000815
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014341   Gene: ENSSHAG00000012252   Transcript: ENSSHAT00000014460
Sequence length 994
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834436.1:994992:1107490:-1 gene:ENSSHAG00000012252 transcript:ENSSHAT00000014460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRIQDKPSSVLTDQFVLALGGIAVVSKNPQILYCRDTFDHPTLIENESICDEFAPNLK
GRPRKKKPCPQRRDSVNGVKDSSNNSDGKTIAKVKCEARSALAKPKNNHSSCKKGSNEEK
SKVAIGEECRAEEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQNLGGYETI
TARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPVKPRKQENN
SQESESKTKLSGTKRIKSENPKNKKEKDHATKPQDTTEVSSEQAKEMPDQRNLTAPLTAM
ELKKQMEGIPAEVLVSRADPEKGDLKDQGSTKEKAEDAKDEEEEEAASSFLSAVLPDDEP
AQIPMVGKELHPSPDVLIDMKQEPQICSFTDTPENELQETPFGSFPTMQHPLASQNEMED
DKLPVMADYIANCTVKVDQLGHDDIHDALKQNPKVLVVQSFDMFKEKELTVPHDDPAFNY
TPLLYSRGNPGIMSPLAKKKLLSQVSGASLSSSYPYGSPPPLISKKKLSGRDELCSGLSQ
AHHGPHADHMVVSRPSVIQHVQSFKSKTSEERKVINEVFKHDKLSKPDPHRCSFSKHHLS
PLAESYVLKSELEESKDKLMEKRALQHSHMPSFLADFYSSPHLHNLYRHTEHHLNNDHTA
KYSPRDMYRESENISAFPSHKHQDKHSVNYHTSLHLQDKKAALEASSDDQPTDLSLPKSA
PKQTGKALGLAHSSMAQQEGKALSQFQVMSSQTNRDCNPKACRVSPMTMSAPKKYIESLP
RSGKPHHVRLENLRKMEGMVHPMIHRKTSPQNIGAARPLKRSLEDLDLVIAGKKIRAVSP
LDSSKEASAKDKASEQEGEGAKPAHGGHPSGSLESHKLPLSSPIFTGLYPGTLCSGLNSR
VPAGYSHPLQYLKNQTVLSPLMQPLAFHSLVMQRGIFTSPANSQQLYRHLAAATPVGSSY
GEILHNSIYPLAAINPQAAFPSSQLSSVHPSTKL
Download sequence
Identical sequences G3WFY6
ENSSHAP00000014341 ENSSHAP00000014341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]