SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014379 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014379
Domain Number 1 Region: 74-203
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.02e-47
Family Regulator of G-protein signaling, RGS 0.0000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014379   Gene: ENSSHAG00000012282   Transcript: ENSSHAT00000014499
Sequence length 213
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856767.1:1000836:1005636:1 gene:ENSSHAG00000012282 transcript:ENSSHAT00000014499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSVMFLTFQPNCGSGSMEKTASGYPMGEEKREKMKRTIIKDWKTRLSYFLQNSSTPGKP
KVNKKGKQQAFIKPSPEEAQLWSETFDELLANKYGLAAFRAFLKSEFCEENIEFWLACED
FKKTKSPQKLTSKARKIYTDFIEKEAPKEINIDFQTKIMIAQNIEEATTGCFTTAQKRVY
SLMENNSYPRFLESEFYQDLCKNPQITRAPQAT
Download sequence
Identical sequences G3WG24
ENSSHAP00000014379 XP_003767581.1.9362 ENSSHAP00000014379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]