SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014417 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014417
Domain Number 1 Region: 59-208
Classification Level Classification E-value
Superfamily C-type lectin-like 1.22e-18
Family C-type lectin domain 0.0089
Further Details:      
 
Domain Number 2 Region: 377-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.027
Further Details:      
 
Domain Number 3 Region: 288-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000706
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 4 Region: 328-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000105
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014417   Gene: ENSSHAG00000012310   Transcript: ENSSHAT00000014537
Sequence length 656
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834719.1:1008011:1011637:1 gene:ENSSHAG00000012310 transcript:ENSSHAT00000014537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQRQQLLVWPSFLAERKLGVTMGTALLPLILLLLSQMLFSPKAWARASNEEEEEAAAVCA
GTACYTAHWGKISAAEAQLNCSTNGGNLATVKSEEEAQHIQEVLTQLPEKGASARTVKFW
IGLQREKSKCMDRDDPLKGFSWVGGGENTSYSNWHKEPMSTCLFKRCASLLLDLSSPASA
HSVPKWSESPCGTPGSPVRNIEGYVCKFSFKGMCHPVALGGPGEVTYTTPFGATSTSLAA
VPFASVANVNCRDGGEKKNHYLLCKERSSNLFDWGTPGPFCASPNHGCAFNNGGCQQECL
EGGDGSFLCGCRPGYRLLDDLVTCIPRDPCHPNPCRGKAKCSPGTHGQHYECQCPAGFKS
TPNRLDCEDVDECSRFFHCTCHLGYETQGHNGMECWDVDECAGDHSPCAQLCINTVGSFQ
CACQKGYQTTGEDGTQCQDVNECEEERNPCEGFCYNIPGSFQCGCLPGWNLAPNGVSCIA
NHNKSGLPEDSHRKNDEKEVLDTTKRSEFTSGASILYNIAPPMEKSSQQTNTPLTQDPSR
PPTYSTQPRIQMVSSITHPTSMITPDGGSQKGESLANESDDTDGQKLLLFYILGTVAATL
LLLAMTLGLVFYRKKKAKRAEKKSPQNAADSYSWVPEQAENRAVENEYSLSPDYSC
Download sequence
Identical sequences G3WG62
ENSSHAP00000014417 ENSSHAP00000014417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]