SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014624 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014624
Domain Number 1 Region: 211-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000206
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 2 Region: 300-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000604
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014624   Gene: ENSSHAG00000012484   Transcript: ENSSHAT00000014746
Sequence length 372
Comment pep:novel scaffold:DEVIL7.0:GL856988.1:1039752:1263082:1 gene:ENSSHAG00000012484 transcript:ENSSHAT00000014746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTD
NIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTILEIIC
TEEYSTGYMTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLKDFFTITDLRIRL
LRPATGEIFVDEQHLARYFYAISDIKVYGRCKCNLHATVCVFDNNKLSCECEHNTTGPDC
GKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISSIGNPPKFDRIWPNISSLEVSNPKQAN
VCDNEFLHCQNGGTCHNNVKCQCPAGYTGILCEKLRCEEAGSCSSDSGHGARAQGSLTLL
VALLGITGPHLF
Download sequence
Identical sequences G3WGR9
ENSSHAP00000014624 ENSSHAP00000014624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]