SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014690 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014690
Domain Number 1 Region: 1325-1487
Classification Level Classification E-value
Superfamily PH domain-like 4.75e-71
Family Pleckstrin-homology domain (PH domain) 0.00000304
Further Details:      
 
Domain Number 2 Region: 1111-1328
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-53
Family DBL homology domain (DH-domain) 0.0000000996
Further Details:      
 
Domain Number 3 Region: 508-623
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-20
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 4 Region: 888-989
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000226
Family Interleukin 16 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014690   Gene: ENSSHAG00000012539   Transcript: ENSSHAT00000014814
Sequence length 1727
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856966.1:1052398:1198596:1 gene:ENSSHAG00000012539 transcript:ENSSHAT00000014814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSESQYSLQGSKNHSNSSTGAKQKPCPLKIRSIHAKDEKSCSLHGWNHGNSGTNYKSR
SLARSCLSHFKSNQPYSSRLSDPMAKGSKGSIHTKHKVNVSGNYFHEKNAAFLSDNGFHY
ISHEPADNHITSRDCNGHLLNCYGKNESLASTPPAEDRKSPKVLIKTLGKWDGCLRVEFH
NSSNNKVPTEDSTGPVQLLRYSPTLETETSNLPEVRRNSSTEYSTGHCLSPTDSRLRSSK
GSSFSSESSWYDSPWGNTGDINELEGSYLTRSTPDTSIHSSFPSDDAKKLFNQSSSLSSL
RELYKDATLESLPPSGIRLSDEYIGTHASLNSRVSFVSDMDVPSRTEQRGPVQYCSYTLP
CRKSKPLTEDTSKKDTLKTRMRRISDWTGSLSRKKRKLQEPKSKDGYDHLDIRTDGLSAE
VLLPSQLSSLLWSSGSGQTLPQRSESTNAISSDPLRQNIYENFMRELEMSRTHVENIETS
TETADSSSDSLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTLQKEKKLELVARRKWKQYW
VTLKGCTLLFYETYGRNSMDQCSSPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYL
FQATSQTDLENWVTAIHSACASLFAKKHGKEDTVRLLKNQTKNLLQKIDMDSKMKKMAEL
QLSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAAASRP
SKLALGRLGILSVSSFHALICSRDESALRKRTLSLTQQGQSKKGLFSSLKGLDTLARKGK
DKRPSITQIFDSSGNHGFPGTQLPQSSNNSSEKNHDEHIYSSASDSGPRENIWEIQTYVH
FPDNQGVTLTIKPEHRVEDILSLACKMKQLDPRYYCLQLRRLIDENIEYSIPAPFEYMQE
QVYDEIEIFPLSVYHVHLSKTENITDFGFAVTAQVDEHQHLNRIFISDVLPDGLGYGEGL
RTGNEILTINGEVVSDLDLRQMESLFSERSVRLSLRANPLDTKRTLGTSWSDSDLSRDQK
NLLPPPNQSQLLEEFLDNLKKNTANDFSNVPDVMAGLKRSQTDGTLDQVSHREKTEHTFR
SAEQIAVLCRNFNETQPNSDGMEGPKEAQEPPPRPLARHLSDADRLRKVIQELMDTEKSY
VKDLTCLFELYLEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISSSSDFNIL
ETPSQFRKLLFSLGGSFLYYADHFKLYSGFCANHIKVQKVLERAKTDKAFKAFLDARNPT
KQHASTLESYLIKPVQRVLKYPLLLKELVSLTDNESEEHYHLTEALKAMEKVASHINEMQ
KIYEDYGTVFDQLVAEQSGTEKEVTELSMGELLLHSTVSWLNPFLSLGKTRKDLELTVFV
FKRAVILVYKENCKLKKKLPSSSRPSHVHGDLDPFKFRWLIPLSALQVRLGNAAGTENNS
IWELIHTKSEIEGRPETIFQLCCSDCESKTNIVKVIRSILRENFRRHIKSELPLEKSCKD
RLIPLKNRVPVSAKLASSRSLRVLKNSSSNEWNSDNGKGNLLDSDECSLSSSTQSSGCHT
TESRQESKDSSPEKYPQTCSSDFSDSLIKESDILSDEDDDFHQTLKKGSPTKDIEIQFQR
LKISEDPDGGSTNEEQPQTEVGNNHNSVEHPKLVRGHFCPIKRKANSTKRDRGTLLTLQA
RHQSLDSKSENANIDLNSILEREFSVQSLTSVVNEECFYETESHGKS
Download sequence
Identical sequences G3WGY5
ENSSHAP00000014690 ENSSHAP00000014690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]