SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014761 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014761
Domain Number 1 Region: 21-177
Classification Level Classification E-value
Superfamily C-type lectin-like 8.75e-20
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 2 Region: 402-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000301
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 3 Region: 283-402
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000282
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 431-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000332
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014761   Gene: ENSSHAG00000012604   Transcript: ENSSHAT00000014886
Sequence length 570
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834719.1:1064261:1065973:1 gene:ENSSHAG00000012604 transcript:ENSSHAT00000014886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLLLPLLSILTLAEPGLPTSSVPQPGGSQCIEDDCYAIFWNPEQFAGANKFCQQLGGH
LMTVRSSVAADVISLLAFGTPEISSPDGRLWIGLQLGVNCSHEQEGQLRGFKWVTGDNST
SYSKWKHSGRGALCGNQCVAVSGDPASGSMELVWEEHSCNLVTEGFLCEYNYPGSCKPLN
LEPSIGASVSYSTPFGGKGADFQALPLNSHASVMPLGLDLVCRKVEETPRWVKESLGAWD
CGVEKGGCSQICRQDGGAPECLCSQGTLSKADLRSCQVEGASCTHSRCQQYCLLSSDAPS
GYICMCDSGYELGEDGHSCVDVDDCAQETNPCPQKCVNKPGAFECECNPGFEMLDGECVK
QISPCFGIKCEHKCLPLEGGTYRCTCEEGFVPVPDQPDRCMLFCNTTACRAKCNPYNVDD
CKCPEGYILDENQMCSDIDECEAGECPGNECINLPGSFRCVCGPKYTPSETEQQCISIEI
NPVDGGSGEPPSTETPDTTTSPPPQGQVHSVVLIGIAISILSIITVLLATVCHLRKKQCA
ARAALDYKCAGPGKEEVLQQVRTDSVPQKL
Download sequence
Identical sequences G3WH56
XP_012395573.1.9362 ENSSHAP00000014761 ENSSHAP00000014761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]