SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014816 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014816
Domain Number 1 Region: 137-388,516-623
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.94e-73
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0015
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily UBA-like 8.35e-22
Family UBA domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014816   Gene: ENSSHAG00000012648   Transcript: ENSSHAT00000014941
Sequence length 1023
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849660.1:1073415:1131925:1 gene:ENSSHAG00000012648 transcript:ENSSHAT00000014941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDERVKEPSQDTIAAEPSEGEGSA
ANKVVPTKVIDPTHDNKDDLQAAIALSLLESPKIQADGRDHNRTHEAATVENKRSKRKRC
EVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSLFQLSEFRRLVLGYSLPQNILEN
CRSHTEKRNIVFMQELQYLFALMMGSNRKFVDPSAALDLLKGAFRSADEQQQDVSEFTHK
LLDWLEDAFQLAVNVNSPRNKSENPMVQLFYGTFLTEGVHEGKTFCNNETFGQYPLQVNG
YRNLDECLEGAMVEGEIEMLPPDHSVKYGQERWFTKLPPVLTFELSRFEFNQSLGQPEKI
HNKLEFPQIIYMDRYMYSSKELIRTKREHIRKLKEEVKVLQQKLERYVKYGSGPARFPLP
DMLQYVLEFASTKPAEEVPPSGHASSLHCPISDLTAKKSIRAEEYSGKVEVSLSSLEKEN
LLQSDLINKPFTSSRPSVKMPEHPAPRTITEEEMNFVKTCLQRWRSEIEQDIQDLKNCIA
TTTQTIEQMYSDPLLHQVPYRLHAVLVHEGQANAGHYWAYIYNRPRNIWLKYNDISVTES
SWEELERDSYGGLRNVSAYCLMYINDKLPHFTAEAAATEPDQMLKEVEALSVELKHYIQE
DNWRFEQEVEEWEEQQSCKIPQIESSTTSESQDFSDTSQEPSLTPSHGVRCLSSEHAVIA
KDQTAQAIANTAYAYEKSGVEAALSEAFHEEYSRLYQLAKETPTPHNDPRLQHVLVYFFQ
NEAPKRVVERTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSL
FRKVSVYLLTGLELYQNGKCHEALSYLVYAYQSNAALLMKGPSRGVEESVIALYRRKCLL
KLNSMAASLFETNEELNVTEGINVMNELIIPCIHLIINNDISKDDLAAIEIMRNHWCSYL
GQDIAENLQLRLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGASAV
TVK
Download sequence
Identical sequences G3WHB1
XP_012400460.1.9362 ENSSHAP00000014816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]