SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014933 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014933
Domain Number 1 Region: 293-508
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-53
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 812-1082
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000231
Family WD40-repeat 0.026
Further Details:      
 
Domain Number 3 Region: 521-605,699-755
Classification Level Classification E-value
Superfamily PH domain-like 0.00000016
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014933   Gene: ENSSHAG00000012742   Transcript: ENSSHAT00000015058
Sequence length 1140
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849752.1:1093457:1281767:-1 gene:ENSSHAG00000012742 transcript:ENSSHAT00000015058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSDPSPQPAVGDQPAQDVPRTSPEAEEDPGEAFEFDDSDEEEEDSRKGPEKDGEAPLI
HFDAAPLTDPAAAQPQPETLAVVSNGESVGAGNRHSSWKRKSSRRVDRFTFPILEEDVIY
DDVPCENLDSHQHGSERSLIYENVHREGGPRESEDLGWSSSEFESYSEDSGEEEVKPEVE
PTKHRVSFQPKLSPDLSRLKERYARTKRDILALRVGGRDMQDLKQRYDCKMTQLMKAAKS
GTKDGLEKTRMAVMRKVSFLHRKEVLGDSEEEDMGFLEVTVSDIKHPAPELGPMPDGLSP
QQVVRRHILRSIVQSEGSYVESLKRILQDYRNPLMEMEPKVLSARKCQVVFFRLKEILQC
HSMFQIALSSRVAEWDTTEKIGDLFVASFSKSMVLDVYSDYVNNFTTAMSIIKKACLTKP
AFLEFLKRRQVSSSDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPKGHPDRLSLQLALTE
LETLAEKLNEQKRLADQLAEIQQLTKSVSDRSSLNKLLTSGQRQLLLCETLTETVYGDRG
QLIKSKERKVFLLNDMLVCANINFKPVNHSRGQLEISSLVPLGPKYVVKWNTSLPQVQVM
EVGQEGGTYDKDNVVIQNAGAKKSSPASQAHNKVYLGPPRLFQELQDLQKDLAVVEQITL
LISTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIHSANKCRLRLLLPGKPDKSGRPISF
MVVFITPNPLSKISWVNRLHLAKIGLREENQPGWKSPDEDKKSKAPFWCPILACCIPAFS
SRTLSLQLRSLIHSPVHSPLLGFSAVSTSLPQGYLWVAGGQDGAGGQVEIFSLNRPTPRM
VKSFPVASPVLCMEYIPEKNEEEEDQESGRPAPDPSSVVHPTICLGLQDGSILVYGSVDT
GTQCLASCKSPGLQPVLCLCYSPHYLFAGLQDGTVAAYPQSSGGLWEMESPPTCLTVGPG
PIRTLLSLEDAVWASCGHQVTVLDATTLQTQQSFEAHQEEAASVTHMVKAGSGVWMAFSL
GASIRLFHTETLEHLQEINIATRTTSLLPGQKQVCVTSLLICQGQLWVGTDQGIIVLLPV
PRLEGIPKITGETRPLSIPTPTTAPKGLLSKRGKVIGRSSVVYGTRIWGHSRGKNNHSHF
Download sequence
Identical sequences G3WHM8
ENSSHAP00000014933 ENSSHAP00000014933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]