SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014971 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014971
Domain Number 1 Region: 335-372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 2 Region: 37-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000183
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 3 Region: 148-242
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000576
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014971   Gene: ENSSHAG00000012773   Transcript: ENSSHAT00000015096
Sequence length 646
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834496.1:1098468:1108729:1 gene:ENSSHAG00000012773 transcript:ENSSHAT00000015096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPVFFLFLLLVPPGGIGAHPDRTPFPNPACRDPPAVLSGVQGSLQWPQGRESHLLPITC
IWVIVGSKEQIVTIRFQKLHLACGSEHLMLQSPLQPLISLCEAPSSPLRFSGGNVTITYG
YAGNGRPPGQGFLLSYTQDRFTCLREEFRCLNHSPHSCLWLLDPHDGRRLIVRFTTLELG
KWDSVHVYDGPGPPDPARLLRTLNYFSNGKAIMVETLSGKATVTYHMGPWNSGGFNATYH
VKGYCLPWDRPCGAGSGEGPGEGPGEGCYSEAQRCDGVWDCADGTDERDCPGCLPGHYPC
GAPGTPGASACYPSADRCNYQTFCVNGADEQQCRHCQPGNFRCRDDRCVYETWVCDGQPD
CSDGSDEWDCAYALPRKVITAAVIGSLICGLLLVIALGCTCKLYAIRTQEYSIFAPLSRV
EAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDVSSGGSSG
SRRRQRGRSTRRLVRRLRRWGLLPRANAPSRTPDSNLQAASAPSTSDAPEGSQGTPLEGA
MGGQDPEEAPPLPLKVPLSSTNTPCTAPEDPPPSTTPPPPPSSLLSGVVQALRGRFMPNL
RSPTPSQATPDPRTVPPSQEDEDDVLLLPLAEPGPWAGEEDEPMLT
Download sequence
Identical sequences G3WHR6
ENSSHAP00000014971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]