SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015054 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015054
Domain Number 1 Region: 21-112
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-17
Family Regulator of G-protein signaling, RGS 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015054   Gene: ENSSHAG00000012847   Transcript: ENSSHAT00000015179
Sequence length 135
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834460.1:1117207:1146140:1 gene:ENSSHAG00000012847 transcript:ENSSHAT00000015179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRIYHVEYFFFLFTHRFSFIFWIGIINSDLLPPIILDSMQEKAKDIYMTFLSSKASSQV
NVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDAS
DSQTVAKRASRIYNT
Download sequence
Identical sequences G3WHZ9
ENSSHAP00000015054 ENSSHAP00000015054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]