SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015148 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015148
Domain Number 1 Region: 532-620
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-21
Family PDZ domain 0.0075
Further Details:      
 
Domain Number 2 Region: 17-92
Classification Level Classification E-value
Superfamily HR1 repeat 2.75e-20
Family HR1 repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015148   Gene: ENSSHAG00000012923   Transcript: ENSSHAT00000015274
Sequence length 687
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841408.1:1132120:1163698:-1 gene:ENSSHAG00000012923 transcript:ENSSHAT00000015274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VERRKEGREKGRKEGKKQGCNPLVQTQRSRLQNHRARINQQINKEMRMRTGAENLFKATT
NHRVKETVALELSYVNSNLQLLKEELEELNSSVDVYQNESEGISVPMIPLGLKETKDLDL
ATPLREMISEHYGEDSTSYEVEIKKLMDLRQAIRTPSRNEAGLELLMEYYNQLYFLDIRF
FSPSRNLGVFFHWYDSLTGVPSHQRTLAFEKGSVLFNIGALYTQIGARQDRGTRKGIDCA
IEAFQRAAGAFNYLKENFSNAPSLDMSIASLSMLVRLMTAQVQECVFEQLTLSGTPREPL
SQMRLAQEAARLSSVYSLVYQTMVQPPVRDYVPFSWTTMVNVKAKHFRGLSHYYAAIALC
DGPAFVAPWHLPSAPCLGLNVGTNAALQPPFVADSEIPKYEKAFLQFHVTVPEGPPLPVL
LQDSEERRKLAKAHLRKAMMNHEEALRLHAVCRILRKMDLLQEVVSLAHRRSLAKYSEID
HEDDFFETAEAPEVHPKTHQKPEIKTPNFSQVKVTDIFHRLGPLSVFSAKNQWRLKGPIL
LTRGEGGFGFTLRGDSPVLIAAVIPGGRAEAAGLKEGDYIVSVNGEPCKWGKHSEVVALL
TGVGEEGVALQVVTPQREEPLGLVEKKATSLSSVGLLRSDKENGGQATLPGPLLGWNKKA
KRGQGLRWLQPFSPSADNTPASRSHWP
Download sequence
Identical sequences G3WI93
ENSSHAP00000015148 ENSSHAP00000015148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]