SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015209 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015209
Domain Number 1 Region: 20-108
Classification Level Classification E-value
Superfamily UBA-like 1.33e-32
Family UBA domain 0.00000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015209   Gene: ENSSHAG00000012970   Transcript: ENSSHAT00000015335
Sequence length 1106
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856821.1:1139103:1181593:1 gene:ENSSHAG00000012970 transcript:ENSSHAT00000015335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSVGTNRARGNWEQTQTQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDI
TGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKDGGQMESNEEG
KENRDRDRDYSRRRGGPPRRGRGASRGREFRGQENGLDGAKAGGPSGRGTERGRRGRGRG
RGGSGRRGGRFSAQGMGTFNPADYAEPTNTDENYGNSSGNTWNNTGSFEPDDGTRLDFMG
VEGSNYPRKFETAPGAWRTATEEWGTEDWNEDLSETKIFTASNVSSVPLPAENVTITAGQ
RIDLAVLLGKTPSSMENESTNLDPSQAPSLAQPLVFSNSKQNTISQPASGSTFSHHSMVS
MLGKGFGDVGEAKGGSTTGSQFLEQFKTAQALAQLAAQHSQSGGSTTTSSWDMGSTTQSP
SLVQYDLKNPSDSTVHSPFTKRQAFTPSSTMMEVFLPEKPPAVTTSTAAPPTPSSPLPSK
STSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKASLTSKIPALAVEMPGSADISGLNLQFG
ALQFGSEPVLSEYESTPTTSASSSQTPSSLYTSTASESSSTISSNQSQESGYQSGPIQST
TYTSQNSAQGPLYEQRSTQTRRYPNSISSSPQKDLTQAKNGFSSVQATQLQTTQSVEGAT
GPAVKSDSPSAPSIPPLNDTVSAASLLTTANQHSSALGSLSHSEELPNTTTTQHSSTLST
QQNTLSSSSSSGRTSTSTLLHTSVESEASLHSSSSTFSTASSTVSAPPPVVSVSSSLNSG
SSLGLSLGSNSTVTASTRSSVATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYG
YDDLQMLQTRFPLDYYSIPFPTPTTPLTGRDGSLASNPYSGDLSKFGRGDASSPAPATTL
AQPQQNQTQTHHTTQQTFLNPALPPGYSYTSLPYYTGVPGLPSTFQYGPAVFPVAPTSSK
QHGVNVSVNASATPFQQPSGYGSHGYNTGVSVTSSNTGVPDISGSVYSKTQQSFEKQGFH
SGTPAASFNLPSALGSGGPINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPY
LQMILCCQRQQEEQDVLSLPDDQLGE
Download sequence
Identical sequences G3WIF4
ENSSHAP00000015209 XP_012403588.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]