SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015527 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015527
Domain Number 1 Region: 19-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000046
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 2 Region: 75-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015527   Gene: ENSSHAG00000013232   Transcript: ENSSHAT00000015655
Sequence length 118
Comment pep:novel scaffold:DEVIL7.0:GL856988.1:1192719:1200704:1 gene:ENSSHAG00000013232 transcript:ENSSHAT00000015655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNPKRCTTCIHFCSSLKDCECFGHSKRCSYIELLNTVICVSCKHNTRGQHCELCRLGYFR
NASAQLDDENVCIECFCNPLGSIHDRCNGTGFCECKTGTTGRKCDECLPGNSWHYGCQ
Download sequence
Identical sequences G3WJC2
ENSSHAP00000015527 ENSSHAP00000015527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]