SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015662 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015662
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000883
Family Methyl-CpG-binding domain, MBD 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015662   Gene: ENSSHAG00000013346   Transcript: ENSSHAT00000015790
Sequence length 257
Comment pep:novel scaffold:DEVIL7.0:GL841420.1:1218454:1234868:-1 gene:ENSSHAG00000013346 transcript:ENSSHAT00000015790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLFSPSGKKFRSKPQLARYLGSSMDLSTFDFRTGKMLMSKMNKNRQRMRYDCSNQAKGK
PDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIA
EELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTSQ
PLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEEIARDGDAPGEKGTAEEEEE
DEEEEEEQDQDHEMETV
Download sequence
Identical sequences G3WJQ7
ENSSHAP00000015662 ENSSHAP00000015662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]