SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015741 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015741
Domain Number 1 Region: 37-112
Classification Level Classification E-value
Superfamily Immunoglobulin 2.75e-19
Family I set domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015741   Gene: ENSSHAG00000013414   Transcript: ENSSHAT00000015869
Sequence length 188
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849657.1:1231400:1237048:-1 gene:ENSSHAG00000013414 transcript:ENSSHAT00000015869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSERKGKRSLFFLVVSRPIFLLPGVLAQTDQGKKPVALDDNRQDGSALLTCNFKGKESVQ
WIAGEMVLNETKKTLNLGSIFKDPQNVYWCRNSAKPEEHSLRLHVYYRMCQNCIKLDGVT
LSGFILAEMITVFFLAVGIYFITGKDGVWQSRASDKQTLLTNDQLYQPLKDKEDDQYSHL
EVSRPRKK
Download sequence
Identical sequences G3WJY6
ENSSHAP00000015741 ENSSHAP00000015741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]