SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015864 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015864
Domain Number 1 Region: 7-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.87e-20
Family Ubiquitin-related 0.0001
Further Details:      
 
Domain Number 2 Region: 467-516
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000187
Family UBA domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015864   Gene: ENSSHAG00000013516   Transcript: ENSSHAT00000015993
Sequence length 520
Comment pep:novel scaffold:DEVIL7.0:GL849739.1:1251254:1252816:-1 gene:ENSSHAG00000013516 transcript:ENSSHAT00000015993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMAGAREEAGDSRLVAGREPPPRIITVTAKTPQERQEFTLAENCSVREFKEQISMRLNCD
VNRLVLIFTGKILRDQDTLSQRGVLDGTTVHLVVRNRFPGFTPSCHLTATPATSNQPIPG
SNSTGSSPSTGAAGLLTRLGRIARGSPDLADFLGHLAQLLMAVPEAVVQFLDDPSIQGLL
GETPSSTNPSGTGPGRLMAQPQTAPPAQAAETVPEALRSPALLRELLMLRADERGLGALK
AVPGGDNALRQVYADIQQLMLTVPASAPRAKGPASLSGPSNSSSSAGPLRLGNVWPGAQG
RVLGASTQATSPYSSSIPNLYMGLGPGSQDMSPTIGKGALPGPSAPSASALRNALNVLHQ
NPSLLHQLTAGSPLRPRLPLLPILTNPRALQAWLQIEQGLQTLSMEIPGLGPCLRGSGRP
HGGHGGGLAGGSNSRVSSQQPTLAVLQLLQALAHASPNALQTPPPPPPLPPPPSEGRFQQ
ELDQLKAMGFSNRDANLQALIATGGDIHAAIERLLGAPQA
Download sequence
Identical sequences G3WKA9
ENSSHAP00000015864 ENSSHAP00000015864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]