SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015910 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015910
Domain Number 1 Region: 144-330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-37
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 2 Region: 34-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-36
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00048
Further Details:      
 
Domain Number 3 Region: 333-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-32
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 4 Region: 967-1020,1082-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-31
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 5 Region: 777-959
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.01e-25
Family Laminin G-like module 0.009
Further Details:      
 
Domain Number 6 Region: 571-632
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000155
Family Fibrinogen C-terminal domain-like 0.0022
Further Details:      
 
Domain Number 7 Region: 542-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000216
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015910   Gene: ENSSHAG00000013557   Transcript: ENSSHAT00000016040
Sequence length 1368
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856823.1:1262633:1280107:-1 gene:ENSSHAG00000013557 transcript:ENSSHAT00000016040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMGISLLCILLAAVTGARGWGWYGCDEELVASLYYRSLGASSYYGFFTGPRFARLHGTSG
WSPAVGDRNPWLQIDLMKKHKIRAVATQGSFNSWDWVTRYMLLYGDRIDSWTPFYQRGHN
STFFGNVNESAVVRHDLHYHITARYIRIVPLAWNPRGKIGLRLGLYGCPYKSDVLYFDGD
DAISYRFPKGVSRTLWDVIAFSFKTEEKEGLLLHSEGIQGDYVTLELKNAQLWMHMSLGN
NPIHGSPGHTTVFAGGVLNDLHWHYLRLDRFGRDVNLTLDGEVQRILLNGDFEKLNLDTE
MFIGGLVRARQKNLAYRENFRGCIENVIFNRVNIADLAVRGHSRISSEGKVAFRCLDPVP
HPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSSLSDGLGHVELMLSDGQVN
VSIAQPGRKKLQFAAGYRLNDGFWHEVNFAAQENTAVISIDDVAGAEFRVSHPLQIRTGI
SYFFGGCPKPASLWGCHSNQTAFHGCMELLKVDGQLVNLTLVEFHRLGKFAEILFDTCGI
TDRCFPNPCEHGGRCYQSWDDFICYCELTGYKGEICHQPLYKESCEAYRLSGKTSGNFTI
DPDGSGPLKPFVVYCDIRENRAWTVVRHDRQWTTRVTGSSQERPFLGAIQYWNASWEEVS
ALANASQHCEQWLEFSCYNSRLLNTAGGYPFSFWIGRNEEQHFYWGGSQPGIQRCACGLD
KSCVDPTLYCNCDADEPQWRTDKGLLTFVDHLPVTQVVVGDTNRSNSEAQFFLKPLRCYG
DRNSWNTISFHTGASLLFPPIRANYSLDVSFYFKTTADSGVFLENQGGRPCQWRRPYLRL
ELNTSRDIVFAFDVGNGDENLTVHAEDIEFNDDEWHLVRAEINVKLARLRVDHRPWEIRP
MPLQTYIWLEYDRPLTVGSAEHKRRPFLGCLRAMRLNGITLNLEGRANASLGTSPNCTGR
CLHPKLPCFHGGRCVERYSYYTCDCDLTAFEGPYCNHDIGGFFEEGTWVRYNLQSALRSA
AQEFSHMLSRPVPGYEPGYVPGYDTPGYVPGYHGPGYQLPDYPRPGRPVPGYRGPVYNVT
GEEVSFSFSTTSAPAILLYVSSFVQDYMAVLIKEDGTLQLRYQLGTSPYVYPLTTRPVTD
GQSHSINITRVYRSLFIQVDYFPMMEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQR
YNTPGFSGCLSGVRFNNVAPLKTHFRAPRPFPREISEALRVQGDLTESNCGAMPHSGFEV
PPELDPWYLPPDFIYYHDDGWVAIIIGFVVTLLLLGLVGLLVLFYLQNHRYKGSYHTHEP
KATHDYHAAGKTPLPPSTPARAPALQPPAPAPARAQNLPQILEESRSE
Download sequence
Identical sequences G3WKF5
ENSSHAP00000015910 ENSSHAP00000015910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]