SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015996 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015996
Domain Number 1 Region: 560-772
Classification Level Classification E-value
Superfamily vWA-like 1.53e-58
Family Integrin A (or I) domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1-192
Classification Level Classification E-value
Superfamily vWA-like 2.5e-51
Family Integrin A (or I) domain 0.0002
Further Details:      
 
Domain Number 3 Region: 393-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000124
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 831-859
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000000235
Family Chicken cartilage matrix protein 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015996   Gene: ENSSHAG00000013621   Transcript: ENSSHAT00000016128
Sequence length 859
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849790.1:1276673:1294473:1 gene:ENSSHAG00000013621 transcript:ENSSHAT00000016128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRTRPTDLVFIIDSSRSVRPHEFEKVKVFLSQVIESLDVGPNTTRVGVINYASAVKHEFP
LKAHRTKASLLQAVHKIEPLSTGTMTGLAIQFAINRAFSEVEGARVKKENYFPFPPKVAI
VVTDGRPQDGVKDVSARAKESGIELFAIGVGRVDKHTLRQIASEPLEEHVDYVESYSVIE
KLSKKFQEAFCDKIAHKCKSMKLYFFSLCLSRERREKDLYICTQKEIYIIYIYIYIYIQR
EIYKWMTRSCQGFLNRRMACLAIVCTKKISLVDTGRIGENGAGGLSYKAFNLVILGSLIC
IGSESFSLGILKPEKERKKEKKESKQERQKWKKKRRKERKEGRRRNTERKDGRKEENKGR
KKEGKEEKKKGMKEERRPRIHPKSLSPSFVVVSDLCATGDHDCQQICTSSPGSYTCSCRD
GFILNSDGKTCSGQCPSKSPSPLPGVGGRGHILGSSNKSHLGLEYGAHLDKGTHDSLLCS
VVLLITSIFLSPIAHHTGLSAKHRDITECYWENWASLCVFRPYSEYSCGELKTMCLSLEQ
RILLRKVSCFCTLPLCFQSFFPSQPPCTFPEFFFLIHSGKGCGACSGGGGGSATDLVFLI
DGSKSVRPENFELVKRFINQIVDSLDVSDKLAQVGLVQYSSSVRQEFPLGRYKTKKDIKA
AVKKMSYMEKGTMTGAALKYLIDNTFTISSGARPGAQKVGIVFTDGRSQDYINDAAKKAK
ELGFKMFAVGVGNAVEDELREIASDPVAEHYFYTADFKTINQIGKKLQTKICVGKLEEWE
RRTLENPVRPDLKRVGLPVIEARKSWEEDIRIVKSIWSPSMAHSCTGVGFDPEEDPCACE
SIVKYQSKVEELLQTLTQK
Download sequence
Identical sequences G3WKP1
ENSSHAP00000015996 ENSSHAP00000015996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]