SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016102 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016102
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-30
Family PDZ domain 0.015
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 4.32e-26
Family L27 domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016102   Gene: ENSSHAG00000013710   Transcript: ENSSHAT00000016235
Sequence length 192
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864887.1:1299552:1344317:-1 gene:ENSSHAG00000013710 transcript:ENSSHAT00000016235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEE
MESRFEKMRYLY
Download sequence
Identical sequences G3WKZ7
ENSSHAP00000016102 XP_012407991.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]