SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016120 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016120
Domain Number 1 Region: 131-225
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-21
Family I set domains 0.0068
Further Details:      
 
Domain Number 2 Region: 237-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000046
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016120   Gene: ENSSHAG00000013720   Transcript: ENSSHAT00000016253
Sequence length 716
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834595.1:1301904:1549803:-1 gene:ENSSHAG00000013720 transcript:ENSSHAT00000016253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFGVSLACYSPSLRSVQDQAFKAPVVVEGKVQGFVQPGGSNSTREPPVSGWVALVKVL
DKWPLRNGGLQRDQVITVGSCAPVERNQRYIFFLEATEEPKVYKTAFPPLDTNGKNLKKE
VGKILCIDCAVPPKLKKMKSQTAQVGEKQSLKCEAAAGYPLPTYRWYKDGKELNRSKDIR
IKYGNGKRNSRLQFNKVKVEDAGEYVCEAENILGKDTAKGKLIVNSVATTLSSWSGHARK
CNESAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKHLGFELK
EAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLAN
GPSHPRLDPEEIQMADYISKNVPATDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHRH
ESHTWSLEQTESLTSDSQSGIMMSSVGTSKCNSPACIEARARREAACNMEDERRPAMPYH
DSVDSLRDSPHSERYVSALTTPARLSPVDFHYSLATQVPTFEIPSPNSAHAVSLPPAAPI
SFRLAEQQPLLRHSPATMAPASDMQRSYDSYYPPRRGCSHDSMGSLPASPFRITEDDEYE
TTQECAPTLEPPKRTSTGHRRWRKSRLNGHMAQRARAVRDSFSLSSASYSESDEELVAEC
TPFLSIHTSDMLGTDSPPLYQPVDSRTYYSLDRHSTQESRHSRITHPRGKQDSAPL
Download sequence
Identical sequences G3WL15
ENSSHAP00000016120 ENSSHAP00000016120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]