SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016122 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016122
Domain Number 1 Region: 131-225
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-21
Family I set domains 0.0068
Further Details:      
 
Domain Number 2 Region: 237-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000492
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016122   Gene: ENSSHAG00000013720   Transcript: ENSSHAT00000016255
Sequence length 708
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834595.1:1301904:1549803:-1 gene:ENSSHAG00000013720 transcript:ENSSHAT00000016255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFGVSLACYSPSLRSVQDQAFKAPVVVEGKVQGFVQPGGSNSTREPPVSGWVALVKVL
DKWPLRNGGLQRDQVITVGSCAPVERNQRYIFFLEATEEPKVYKTAFPPLDTNGKNLKKE
VGKILCIDCAVPPKLKKMKSQTAQVGEKQSLKCEAAAGYPLPTYRWYKDGKELNRSKDIR
IKYGNGKRNSRLQFNKVKVEDAGEYVCEAENILGKDTAKGKLIVNSVATTLSSWSGHARK
CNESAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQK
RVLTITGICVALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLD
PEEIQMADYISKNVPATDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLE
QTESLTSDSQSGIMMSSVGTSKCNSPACIEARARREAACNMEDERRPAMPYHDSVDSLRD
SPHSERYVSALTTPARLSPVDFHYSLATQVPTFEIPSPNSAHAVSLPPAAPISFRLAEQQ
PLLRHSPATMAPASDMQRSYDSYYPPRRGCSHDSMGSLPASPFRITEDDEYETTQECAPT
LEPPKRTSTGHRRWRKSRLNGHMAQRARAVRDSFSLSSASYSESDEELVAECTPFLSIHT
SDMLGTDSPPLYQPVDSRTYYSLDRHSTQESRHSRITHPRGKQDSAPL
Download sequence
Identical sequences G3WL17
ENSSHAP00000016122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]