SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016208 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016208
Domain Number 1 Region: 3956-4162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.19e-32
Family Laminin G-like module 0.0054
Further Details:      
 
Domain Number 2 Region: 238-358
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-31
Family Cadherin 0.00063
Further Details:      
 
Domain Number 3 Region: 2663-2773
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-31
Family Cadherin 0.00041
Further Details:      
 
Domain Number 4 Region: 2140-2270
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-31
Family Cadherin 0.0007
Further Details:      
 
Domain Number 5 Region: 1307-1418
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-29
Family Cadherin 0.0014
Further Details:      
 
Domain Number 6 Region: 680-783
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 461-582
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-28
Family Cadherin 0.00076
Further Details:      
 
Domain Number 8 Region: 3182-3290
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-28
Family Cadherin 0.00054
Further Details:      
 
Domain Number 9 Region: 3393-3515
Classification Level Classification E-value
Superfamily Cadherin-like 4.84e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 3083-3194
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-28
Family Cadherin 0.0014
Further Details:      
 
Domain Number 11 Region: 2355-2458
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-27
Family Cadherin 0.00038
Further Details:      
 
Domain Number 12 Region: 1931-2054
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-27
Family Cadherin 0.00063
Further Details:      
 
Domain Number 13 Region: 2042-2144
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 14 Region: 1406-1534
Classification Level Classification E-value
Superfamily Cadherin-like 5.76e-27
Family Cadherin 0.0018
Further Details:      
 
Domain Number 15 Region: 1202-1313
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-27
Family Cadherin 0.00038
Further Details:      
 
Domain Number 16 Region: 987-1090
Classification Level Classification E-value
Superfamily Cadherin-like 2e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 17 Region: 1833-1942
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-26
Family Cadherin 0.00073
Further Details:      
 
Domain Number 18 Region: 879-986
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-25
Family Cadherin 0.0039
Further Details:      
 
Domain Number 19 Region: 4179-4403
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-25
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 20 Region: 2251-2362
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-25
Family Cadherin 0.0022
Further Details:      
 
Domain Number 21 Region: 573-680
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-24
Family Cadherin 0.00089
Further Details:      
 
Domain Number 22 Region: 1731-1831
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 23 Region: 786-891
Classification Level Classification E-value
Superfamily Cadherin-like 4e-23
Family Cadherin 0.0022
Further Details:      
 
Domain Number 24 Region: 2454-2567
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-23
Family Cadherin 0.0051
Further Details:      
 
Domain Number 25 Region: 2971-3087
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 26 Region: 2865-2975
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 27 Region: 2767-2872
Classification Level Classification E-value
Superfamily Cadherin-like 1.15e-21
Family Cadherin 0.0014
Further Details:      
 
Domain Number 28 Region: 1086-1202
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-20
Family Cadherin 0.0027
Further Details:      
 
Domain Number 29 Region: 3292-3397
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 30 Region: 129-250
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 31 Region: 3503-3606
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-19
Family Cadherin 0.0013
Further Details:      
 
Domain Number 32 Region: 2564-2669
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-18
Family Cadherin 0.0039
Further Details:      
 
Domain Number 33 Region: 346-465
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-17
Family Cadherin 0.0012
Further Details:      
 
Domain Number 34 Region: 1515-1621
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000003
Family Cadherin 0.0026
Further Details:      
 
Domain Number 35 Region: 3849-3975
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000439
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 36 Region: 1624-1738
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000157
Family Cadherin 0.0034
Further Details:      
 
Domain Number 37 Region: 68-135
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000104
Family Cadherin 0.0073
Further Details:      
 
Domain Number 38 Region: 4427-4463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000367
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016208   Gene: ENSSHAG00000013795   Transcript: ENSSHAT00000016342
Sequence length 4980
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864726.1:1320912:1549794:-1 gene:ENSSHAG00000013795 transcript:ENSSHAT00000016342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLCAPGTRGRWGFLLPTLPPLAPLVLGLLWALPGQAAGSAGTEQRQVFQVLEEQPPGTL
VGTIQTRPGFTYRLSESHALFTINSSTGALHTTATIDRESLPSDVINLVVLSSAPTYPTE
VRVLVRDLNDNAPVFPEPSIVVTFKEDSSSGRQVILDTATDADIGSNGVDHRSYRIVGGN
EAGRFRLDITLNPSGEGAFLHLVSRGGLDREATAYYQLLVEVEDKGEPKRRGYLQVNVTV
QDINDNPPVFGSSHYQAGVPEDAAVGSSVLQVSAADADEGTNADIRYQLQEDGGPFHMDP
ETGLITVREPLDYEARRQYSLTLQAHDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPA
TSRFASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLSLI
KVASALDRERIPSYNLTVSVSDNHGAPPGAVARSSVASLVIFVNDINDHPPVFSQLVYRV
NLSEEAPPGSYVSGVSATDGDSGLNANLRYSIISGNELDWFHISDHSGLVTTAAAGGLDR
ERASQVVLNISARDQGVHPKVSYAQLIVTVLDVNDEKPVFSQEAGYEVSVAENAPAGTDL
LVIEASDGDLGDNGTVRFSFQEADTEQRSFRLDPVSGRLSTISSLDREEQAFYSLLVLAV
DLGSPPQTSLTRVNVSLLDVNDNSPVFYPVQYFAHIQENEPAGSYITTVSASDPDSGPNG
TVKYSISAGDTSRFQIHSHTGVISTKMVLDREEKTAYQLQVVATDGGHLQSPNQAIVTIT
VLDTQDNPPVFSQAVYSFVVFENVALGYHVGSVSASTMDLNTNITYVITTGDQKGVFAIN
QVTGQLTTASIIDREEQSFYQLKVVASGGMVTGETIVNITVKDLNDNAPHFLQAVEWVNV
VENWQAGHSIFQAKALDPDEGINGMVLYSLKQNPKNLFTIDEKNGNISLLRPLDVHAGSY
QVEILASDRGVPQLSSSFILTVSVHDVNDNPPVFDQLSYEVTLSEAQPVNSLFFKVQASD
QDSGANGEIAYSIAEGNTGNAFGIFPDGQLYVKSELDRELQDRYVLLVVASDRAVEPLSA
TVNVTVILEDVNDNRPLFNSTNYVFYFEEEQRGGSFVGMINAIDKDFGPNGEVRYSFETM
QPDFELNAISGEITSTHQFDRESLMRQRGAAVFSFTVTASDQGLPKPLKDQATVQVYMKD
INDNAPKFLKDFYQATISELAANLTQVLRVSASDVDEGSNGLIHYSVVKGNEEKMFAIDS
ATGQVILAGQLDHEATASYSLLIQAVDSGTVSLNSTCTLSIDILDENDNTPSFPKSTLFV
DVLENMRIGELVTSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGGIFLAKKLDFET
QPLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPTFPPGDIFKSITENLPIGSSVISV
TARDPDADINGQLTYAIIQQMPRGNHFGIDEVKGTIYTNAEIDREFANLFELTVKASDQA
VPIETRRFALKNVTILVTDLNDNVPMFISQNALAADPSVMIGSILTTIVAADPDEGANGE
VEYEIINGDTETFMVDRYSGDLRVSSALVPSQLIYSLIISATDLGPERRKSTTEMTIILQ
GLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVAVRCQEKAAGRLFT
IGRHTGIIQTAAILDREQGAHLYLVDVYAIEKSTVFPRTQRAEVEITLQDINDNPPVFPT
DTLDLTVEENIGDGSRIMQLTAMDADEGANALVTYAIISGADDSFHIDPESGELIATKRL
DRERRSKYSLLVRADDGLQSSDMRINITISDVNDHIPKFSRPVYSFDIPEDTTPGSLVAA
ILATDDDSGVNGEITYTVNEDDEDGIFFLNPVTGVFNLTRSLDYETRQYYILTARAEDGG
GQFMTIRIYFNILDVNDNPPVFSSTSYSTSLMENLPLGSTILIFNVTDADDGLNSQLSYS
ITSGDSLGQFTVDKNGILKIRQTLDRESQSFYNLVIQVHDMPLSSTSSYTSTAQVSIILL
DVNDNAPTFISPKLTYVPENTPTDTVVFKAQATDRDSGPNSYIEYTLLNPLGNKFSIGTI
DGEVRLTGELDREEVSNYTLTVVATDKGQPPLSSSTEVAVIILDINDNNPVFAKALYKVE
INENTLTGTDIVQVYAADGDEGTNGQVRYSLLSGNENQEFRIDSVTGILSVAKPLDREKK
AMYSLTVQSADRGSSPRMDTTKVDIILLDINDFVPVFELSPYSINIPENLEALPKTILQV
VARDDDQGSNSKLTYTLIGGNEDNAFILSASGELKVRQKLDRETKEKCILLITATDSGSP
ALTGTGTVNVIVSDVNDNVPTFAHKTYSATISEDAPTGSDVLLVSASDADASTNAVISYR
LIGGNSQFTINPSTGQIITSALLDRETKENYTLIVVSSDGGFPEPLSSSTSVSVTVTDVN
DNPPRFQHHPYVTHIPSPTPSGSFVFSVTVTDPDTGPNSELHYSLTGRNSEKFHIDPLRG
AIMAAELLNTASEMTFFVHVKDGGLSPKMDSTTVTVRFGNKGDFPKIRAKQHTFLFPESQ
PIGTLITTITGSSSRGEPLSYFIASGNLGGAFHIDQLTGQVSISQQLDFETVQKYVVWIE
ARDAGFPPFSSYEKLAIAVLDVNDNSPVFKDDPFVAEILENLSPRTILTVSAIDKDSGPN
GQLEYNIVNGNTENSFSIHHSTGEIRSIRSLDREKVSQYVLTVRCSDKGTPPQSTTVTVI
INVLDENDNAPRFSQIFTAPVPENAPLGYTVTRVTTSDEDIGVNAVSRYSITDTSLPFTI
NPSTGDIIISRPLNREDTDRYRIRVSAHDSGWTVSTDVAIFVTDVNDNAPRFKKPSYYLD
CPELTEIGAKVAQVSATDPDEGSNGQVFYFIKSQSEFFRINATTGEIFNKQALRYRNVTG
SSNVNINRHSFIVTSSDRGSPSLLSETTVTINIVDSNDNAPQFLNSKYFTPVTKNVRVGT
KLLKVTAIDDKDFGLNSEIEYFISNETPVEKFKLDSTTGWVSVASSLISDLNQNFLMTVI
ARDKGNPPLSSQATVQIVVTEENYHSPEFSQSHISATVPESQSVGSIVRTVSARDRDAAM
NGLITYHISSGNENGLFAINASTGTLTLAKPLDYELHQKHEMTISATDGGWRARTSYCSI
IINVLDVNDNSPIFIPEEYSPTVLENAPSGTTVMRLNATDADSGSNAVIAYSLQSSDSDL
FVIDPNSGVITTQGFLDYETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVS
KLYYFEVSEAASKGTVVGEVFASDRDMGVDGEVHYLIFGTSRKKGFQINSRTGQIYVSGF
LDREKEERISLKVLAKNSGSIRGADVDEVTVNITILDANDPPVFSLEIYNVQISEGVPIG
THVTFVSAFDSDSVPSWSRFSYFIGSGNENGVFSINPQTGQITVTAELDRETLPVYNLTV
LAVDLGTPPATGSASLLVTLEDINDNGPTLSTKEGEVMENKRAGTLVMTLQSIDPDLPPN
QGPFTYYLLSTGPATSYFSLSTAGVLTTTREIDREQIGDFYLSVITRDSGIPQMSSTGTV
HIRVIDQNDNPSEPRTVEIFVHYFSNLFPGGILGSVKPQDPDVLDSFHCSLTSGVTSLFS
IPSGTCDLNSQARSTDGTFDLTVLSNDGLHSAVSNNIRVFFAGFTNATVDNSILLRLSVP
TVRDFLTNHYLHFLRIASSQLTGLGTAVQLYGAYEENNRTFLLAAVKRNTNQYVNPSGVA
TFFESIKEILLRQSGVRVESVDHDPCVHGPCQNGGSCLRRLAVSPTMKSHESLPVIIVTN
EPLQPFFCKCLPGYAGSWCETDIDECLPSPCHNGGTCHNLVGGFSCSCPEGFTGRACERD
INECLPKPCKNGAICQNFPGSFNCVCKAGFTGKTCESSVNYCECNPCFNGGSCQSGIESY
YCHCPFGVFGKHCELNSYGFEELSYMEFPSLDPNNNYIYVKFATIKSHALLLYNYDNQTG
ERAEFLALEIAEERLRFSYNIGSGTYKLTTMKKVSDGHFHTVIARRAGMAASLTVDSCSE
DQEPGYCTVSTMAVSDDWTLDVQPNRVTVGGIRSLEPVLQRKGQVESYDFVGCIMEFAIN
GRPLEPSQALAAHGILDRCPRLEGACANSPCQHGGTCTDHWSWQQCQCKEGLTGKYCEKS
MTPDTALSLEGKGRLDYHMSQSRKWEYLLRQNIRGDVIEPFGVNSLEVKFRTRSENGILI
HIQESSNYTTVKIKNGKIHFTSDAGVSGKVERHIPEVYVADGHWHSLLMGKNGSSTILSI
DRMYSRDILHPTQDFGGIDVLTISLGGIPPNQAPRNTDTGFDGCIASVIYGSESLPFGGK
HSLATISKTDPSVKLGCRGPNICASNPCWGDLLCINQWFAYKCVPPGDCASQPCQNGGSC
EPVSYSGFTCSCPESHTGRTCETVVACLGVQCPQGSICKAGSAGGHVCILTKVPEEISLP
LWAVPAIVGSCATLLVLLVLSLILCNQCRSKKAKAPKEEKKIKEKKKKGSENVAFDDPDN
IPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDLPPNTETIPSAPLASPEQEIEHYD
IDNASSIAPSDADIIQHYKQFRSHTPKFSIQRHSPLGFARQSPMPLGASSLTYQPSYSQG
LRTSSLSHSACPTPNPLSRHSPAPFSKSSTFYRNSPARELHLSIREGGPLEMHGDVCQPG
IFNYATRLGRRSKSPQTMATGSRPGSRLKQPIGQMPLESTPPVGLSIEEVERLNTPRPRN
PSICSADHGRSSSEEDCRRPLSRTRNPADGIPAPESSSDSDSHESFTCSEMEYDREKPMV
YTSRMPKLSQVNESDADDEDNYGARLKTRRYPGRRAEGGSMGPQTAAAMNVAENTLPLKL
GQQAGNFNWDNLLNWGPGFGHYVDVFKDLASLPEKTTANEEGSGRTSKPASKDGEAEQYV
Download sequence
Identical sequences G3WLA3
ENSSHAP00000016208 ENSSHAP00000016208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]