SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016302 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016302
Domain Number 1 Region: 93-167
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.63e-25
Family Regulator of G-protein signaling, RGS 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016302   Gene: ENSSHAG00000013870   Transcript: ENSSHAT00000016437
Sequence length 174
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841258.1:1337727:1362853:-1 gene:ENSSHAG00000013870 transcript:ENSSHAT00000016437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLSLSQPMGSERMEMRKRQMSVPQETADCTTGQHEVGNRASNACCFCWCCCCSCSCLTV
RNQEDERARRASYELRTEGLPTCEESPTPTLEEVNAWAQSFDKLMVTPAGRNIFREFLRT
EFSEENMLFWMACEELKQEVNKSVIEEKARLIYEDYISILSPKEVGDNSLDYFY
Download sequence
Identical sequences G3WLJ7
ENSSHAP00000016302 ENSSHAP00000016302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]