SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016354 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016354
Domain Number 1 Region: 427-684
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.74e-76
Family Eukaryotic proteases 0.000000611
Further Details:      
 
Domain Number 2 Region: 26-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-32
Family Spermadhesin, CUB domain 0.00000291
Further Details:      
 
Domain Number 3 Region: 183-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-28
Family Spermadhesin, CUB domain 0.00000395
Further Details:      
 
Domain Number 4 Region: 366-437
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000117
Family Complement control module/SCR domain 0.0000457
Further Details:      
 
Domain Number 5 Region: 300-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.00036
Further Details:      
 
Domain Number 6 Region: 135-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000439
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016354   Gene: ENSSHAG00000013917   Transcript: ENSSHAT00000016491
Sequence length 688
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849747.1:1349965:1376990:1 gene:ENSSHAG00000013917 transcript:ENSSHAT00000016491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLRLSFLLAMSLQQVGGDPWPKAVFGRLASPGFPEVYPNNEEQSWNLMAPPGYQIRLY
FTHFNLELSYLCEYDFVKLYSGDKLLATLCGQESTDTEQAPGNHTFHSEGNRLRVAFRSD
YSNEKDFTGFEAFYAAEDIDECEVPPGEDPICDHHCHNYLGGFYCSCRAGFKLHKDKHTC
SAQCSGQVFTERSGVIISPDYPQVYPKLSSCSYSIQVEDGFNIILEFEDSFDVETHPETL
CPYDVLKIKTDKEEYGPFCGQTLPPKIYTKSHSVTITFITDDSGDHTGWKIRYLTTAQPC
PNPISPPHGRIAPVQPKYILKDHFSLSCETGYVLSKDERILESFTAVCQKGGTWDQAMPK
CSIVDCGPPDDLFNGQVTYITDSEVTTYEAVIQYSCKGPFYTMKMNNDGKYQCGADGFWK
NSKGEYSLPVCEPVCGVASQRLERVLGGRKAKLGEFPWQVMLLGDALAGGALLHDNWVLT
AAHAIHEQRDLGSLEIKMGLLKRSSPHYTEGWADKVFIHEGYTYDGVNFDNDIALIKLKN
HVQINSNVTPICLPRKNGTRVKTNDLGTVSGWGRTEKGFRAHSLMYVELPVVDQQTCRAA
LENKTSPEGKSLILTDNMICAGFQSGGKDSCSGDSGGPFAFQDHETKKWFVGGIVSWGLG
CGEANQYGMYTNVINYIPWIENIILNNS
Download sequence
Identical sequences G3WLP9
ENSSHAP00000016354 ENSSHAP00000016354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]