SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016404 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016404
Domain Number 1 Region: 16-114
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-20
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 
Domain Number 2 Region: 1011-1151
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000085
Family Nucleotide and nucleoside kinases 0.0055
Further Details:      
 
Domain Number 3 Region: 682-763
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000146
Family PDZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016404   Gene: ENSSHAG00000013958   Transcript: ENSSHAT00000016541
Sequence length 1156
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841501.1:1360294:1501804:-1 gene:ENSSHAG00000013958 transcript:ENSSHAT00000016541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEPEMGDYMETLKNEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLSA
PMLPSKINRSGRLLDILHTKGERGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVVEEG
HEGLTHFLMNEVIKLQQQMKAKDVQRCELLAKSRQLEDEKKQLTLTRVELMTFQERYHKM
KEERDNYNDELIKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKMEEEC
KLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKIQELQSIIQAGKRSLPDSDKAILD
ILEHDRKEALEDRQELVNKIYNLQEEMRQAEELRDKYLEEKEDLELKCSTLGKDCDMYKH
RMNTVMIQLEEVEKERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDELRIEMVR
KEACIVNLESKLRRLSKDNSGLDQSLPRNLPVTIISQTFGDSSPKTNGQEADDSSTSEDS
PEDSKYFLPYHPPKRRMNLKGIQLQRAKSPVSMKRASDFQDMMYSEQGLESNNKDASSNS
STPLSIDNSLNKMLPLRNRNSIMSITAEPPGNDSIVRRCKEDVPHRSIIEEDTDSFGFDA
LDLDDDNHDRYSFGPPSIHSSSSSHQSESLDAFDLEQVNIMFRKFSLERPFRPSVTSVGH
IKTTCHPVQHTTLNGDNLITEITLLGGNDRGSFIHSVKPGSLAEKEGLREGHQLLLLEGC
IKGEKQSVPLDTCTKEEAHWTIQRCNGPVTLHYKFNHEGYRKLLKDMEDGLITSGDSFYI
RLNLNISSQLDSCSMSLKCDEVVHVRDTMYQDKYEWLCARVDPFNNRDLEMGTIPSYSRA
QQLLLVKLQRLMHRGNRDETENTHHTLRALRNTLQPEEPLAMNDPRVSPRLSRASILFGQ
LIQFVSRSENKYKRMNSNERVRIISSGHPGNLARASLDVLKPLSEKHEDVDTESDLNKSL
NLIPYSLVRSFYSERRRPVLFTPTMLAKTLVQKLLNSGGAMEFNMCKPDIVTKEEFLRKE
RTETIIFSREKNPNTFECIVPANIEAVAAKNKHCLLEAGISCTKDLIKAKIYPIVLFIRV
SEKNIKKFRKLLPRPETEEEFLRVCRQKEKELEALPCLYASVEVEMWSSVEDLIRVIKEK
IGEEQRKTIWIDEDQL
Download sequence
Identical sequences G3WLU9
ENSSHAP00000016404 ENSSHAP00000016404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]