SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016405 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016405
Domain Number 1 Region: 12-110
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-20
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 
Domain Number 2 Region: 997-1137
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000836
Family Nucleotide and nucleoside kinases 0.0055
Further Details:      
 
Domain Number 3 Region: 668-749
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000146
Family PDZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016405   Gene: ENSSHAG00000013958   Transcript: ENSSHAT00000016542
Sequence length 1142
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841501.1:1360294:1501804:-1 gene:ENSSHAG00000013958 transcript:ENSSHAT00000016542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDYMETLKNEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLSAPMLP
SKINRSGRLLDILHTKGERGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVVEEGHEGL
THFLMNEVIKLQQQMKAKDVQRCELLAKSRQLEDEKKQLTLTRVELMTFQERYHKMKEER
DNYNDELIKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKMEEECKLER
NQSLKLKNDIENRPKKEQVLELERENEMLKTKIQELQSIIQAGKRSLPDSDKAILDILEH
DRKEALEDRQELVNKIYNLQEEMRQAEELRDKYLEEKEDLELKCSTLGKDCDMYKHRMNT
VMIQLEEVEKERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDELRIEMVRKEAC
IVNLESKLRRLSKDNSGLDQSLPRNLPVTIISQTFGDSSPKTNGQEADDSSTSEDSPEDS
KYFLPYHPPKRRMNLKGIQLQRAKSPVSMKRASDFQENGMDASSNSSTPLSIDNSLNKML
PLRNRNSIMSITAEPPGNDSIVRRCKEDVPHRSIIEEDTDSFGFDALDLDDDNHDRYSFG
PPSIHSSSSSHQSESLDAFDLEQVNIMFRKFSLERPFRPSVTSVGHIKTTCHPVQHTTLN
GDNLITEITLLGGNDRGSFIHSVKPGSLAEKEGLREGHQLLLLEGCIKGEKQSVPLDTCT
KEEAHWTIQRCNGPVTLHYKFNHEGYRKLLKDMEDGLITSGDSFYIRLNLNISSQLDSCS
MSLKCDEVVHVRDTMYQDKYEWLCARVDPFNNRDLEMGTIPSYSRAQQLLLVKLQRLMHR
GNRDETENTHHTLRALRNTLQPEEPLAMNDPRVSPRLSRASILFGQLIQFVSRSENKYKR
MNSNERVRIISSGHPGNLARASLDVLKPLSEKHEDVDTESDLNKSLNLIPYSLVRSFYSE
RRRPVLFTPTMLAKTLVQKLLNSGGAMEFNMCKPDIVTKEEFLRKERTETIIFSREKNPN
TFECIVPANIEAVAAKNKHCLLEAGISCTKDLIKAKIYPIVLFIRVSEKNIKKFRKLLPR
PETEEEFLRVCRQKEKELEALPCLYASVEVEMWSSVEDLIRVIKEKIGEEQRKTIWIDED
QL
Download sequence
Identical sequences G3WLV0
ENSSHAP00000016405 XP_012398278.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]