SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016476 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016476
Domain Number 1 Region: 45-214
Classification Level Classification E-value
Superfamily vWA-like 1.27e-45
Family Integrin A (or I) domain 0.00091
Further Details:      
 
Domain Number 2 Region: 523-711
Classification Level Classification E-value
Superfamily vWA-like 7.86e-45
Family Integrin A (or I) domain 0.0014
Further Details:      
 
Domain Number 3 Region: 298-522
Classification Level Classification E-value
Superfamily vWA-like 9.64e-37
Family Integrin A (or I) domain 0.0032
Further Details:      
 
Domain Number 4 Region: 716-751
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000323
Family EGF-type module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016476   Gene: ENSSHAG00000014016   Transcript: ENSSHAT00000016613
Sequence length 755
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834463.1:1375599:1412433:-1 gene:ENSSHAG00000014016 transcript:ENSSHAT00000016613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLILFLEAICIFLFGQVLPSFTIQDLYVNQETVVKISAASQLMQCSAALDVLFALDGSH
SIGKGSFERSKYFAIKLCDTLTIDPDKVRVGVLQFSSIPQLEFPLDSFYTREEVKEKIKK
TVFKGGSTETGLALKYLLHKGFPGGRNSSIPQILVIVTDGKSQGNIALLAKQLKEKGVVV
FAVGVRFPRWTELHILASEPKDQYMLFAEHVDDATNGLYSTLSSLGICNATAPGCRIEPH
LCERKTLETIREVTGNSLCWRGSKKTNAVISSLCPFYSWKKVFITHPATCYRTVCPDPCD
SQPCQNGGTCVLEGLDKYHCLCPFGFGGEANCAPKLSLECSVNILFLLDSSSGTTLEGFL
QAKAFLKRFVQAVVNMDSPVNVAVAQYSQEVEIPIQMGEYEDVPSLMKSLDRMHFTGGAT
LTSRALEYVTDHGFRDTLPLGETHDPQPRRVVVLLTDSRSQDLVAGSVKYARDRNLFLIG
VGSEFLRAELEEITGNPKQVITYSNPQDLFNKIPELQKKICTLQKPGCQSQSLDLVFLLD
ASATMGQENFLKVQSFVRESSLQFNINRDVTQIGLVVYGRRVQTTFALDTHPTSSSLLQA
INQAPYLGGTGSTGSALLHVYDEVMTVQKGARPGVSKAVVVITEGTGTEDAVVPAQKLRN
NGISILVISVGPVLKETLLRLAGSHDFLIHVPSYEDLKNYQDLFIEKICEEAKRPANLCK
PSPCMNDGTCILQNGSYRCECRGWEGPHCENTFLK
Download sequence
Identical sequences G3WM21
ENSSHAP00000016476 ENSSHAP00000016476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]