SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016669 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016669
Domain Number 1 Region: 224-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000954
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 2 Region: 185-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 144-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000043
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 106-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016669   Gene: ENSSHAG00000014178   Transcript: ENSSHAT00000016809
Sequence length 396
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856887.1:1413664:1416954:-1 gene:ENSSHAG00000014178 transcript:ENSSHAT00000016809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRPSLLGPALTMPHGCRCLQLVSLLWILGASGQPTPANDCSSHCDLAHGCCEPDGTCRCD
PGWEGLHCERCVRMPGCQHGTCHQPWQCICHNGWAGKFCDKDEHICTKQPPCQNGGKCVY
EGDGEYHCVCPPGFHGHNCERKTGPCEHAGSPCRNGGQCQDDQGFAKNFTCRCLAGFVGP
RCEVNVDDCLMRPCANGATCHDGINRFSCHCPEGFAGRFCTINLDDCASRPCQHGARCRD
RVHDFDCLCPDGYGGKTCEIALPALDLPTEPESAAGSTPAAVVPFTVPAPFSVGAGLLRI
SVKEVVRRQEAGLGESSLLVLVIFGVLTATLVLTTGLLIFWAWCHGHCPAGLCCYPFRQY
AIPPEQHDQECQVSMLPAGISPPPGSPPEPGKTTAL
Download sequence
Identical sequences G3WML4
ENSSHAP00000016669 ENSSHAP00000016669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]