SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016695 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016695
Domain Number 1 Region: 20-111
Classification Level Classification E-value
Superfamily SET domain 4.97e-23
Family Histone lysine methyltransferases 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016695   Gene: ENSSHAG00000014202   Transcript: ENSSHAT00000016836
Sequence length 270
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856796.1:1418467:1648368:1 gene:ENSSHAG00000014202 transcript:ENSSHAT00000016836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFPKCLSVNPDFSLLFLQVICNGFTISNGEMQEVGVGLYPSMSLLNHSCDPNCVIVFEG
PSLFLRAIRNIPLGEELTICYLDVLMPTAERQKQLKEQYCFDCDCPLCKTQSKDADMLAG
EEQAWKEIQGSLIKIEDLQSQEKWEQVLAMCQTLINNCGNRLPDRNIYQLKMLECAMDAC
INLSLWEDALLYGSRTLEPYRLYYPGFHPVRGVQVMKVGKLQQHQGLYPQALETLKQAFE
LIKVTHGRDHSLIEDLMLLLGDCEANLRVG
Download sequence
Identical sequences G3WMP0
ENSSHAP00000016695 ENSSHAP00000016695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]