SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016725 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016725
Domain Number 1 Region: 1183-1224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000325
Family EGF-type module 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016725   Gene: ENSSHAG00000014230   Transcript: ENSSHAT00000016867
Sequence length 1487
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861715.1:1423909:1459161:-1 gene:ENSSHAG00000014230 transcript:ENSSHAT00000016867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQECSPGGHQILQNPRRNVAFDVSGAQPPTELICDRSLRPGWYRFQLSGSPAEMPTACVK
AGRCGTQVPLWLSLRGGEAPPLPGETTPLTACASWDFLGAAQDCCLFRAPVTVRNCGPFL
IYFLQPTQGCMGYCAEGILDICFRPTWPAGAEEAEVGRVCEGPPAVPSLPSPPGALKVEL
KWIATKIFLQCTFEGSPTNGSLGFVITWSRLSSEGFREELKKEITVEESSLLELDGINLR
LGDRIFCGVSAFFRENPDIQSAVIQSKEFFAGIKLQPEVSTVSEDGQEHQLRLESTVPIL
CPEPGQGCKISLTLKTIDQGNGQQGFNLALSRCQVELPETTSCENGTCSRAVIYFTAIID
FSRDGDRISEIAVEPIVSENFLWSSYIPESIQIRVKDLPTASCYSFTDPHIITLDGRHYE
HFKTGTFVLYKSVSRDFEVHVRQWDCGSLHYPVACNCGFVAKEGGDVVALDMCSGQLHES
QPYLSVKSRDPASNVKIKESYLGRKVTVFFSSGAFVRADLSEWGMSLTVQSPGSDYGSTR
GLCGTFDGDPENDFHDQRGSPLKERPDPYLAFISEWRLSPGRSMFDELPRPLKSPGKISY
CSCAGAEAGSPWVSAPGSPSPSGAASGCRDAERVRRPSLIPELDVAMDADGPSRSFRRRS
LKEEKHPGPFFPSQEKYAHLTRGESEGAIGQRNGRGKPAPLEAGDPPPRERPSARSRQKR
EHLRGHLPAFSVPDLGPADLEGLSYFFPEDHAADAQPEPAPSWPTPSGLTEARVGEVCRQ
RLANSSMGGACAGFLGERLDSALAMCVKDVLLKDNLGWADAGLALLENECERRVLQEGAH
SPEGDGRAPEDVLLALRSTGLCSGRGQCMEWGCACSQGFSSFDCSVWSDQAPEITELENA
GLCDIQLSGCTAVRVFGHGFRESRTPKCEVTPQQYNGSQGIPGAPVYTDVVFQNSTTVTC
RLPAHVQKLPTMDQWGDGPIVKWQVKVSNDGLRFSNPQILTLYDGACQTCDPRGRCTLKE
KLCLVDGRCYRDGAPSPTGPCRLCRSDLSRWTWSVSPDNRPPVFHEAPQRLWTFYGANFT
QQLRATDPEGSPVSYTLRAGPRAAGVSPGGVLLWKALSWGAHTFTVGAADDCRAEATVTV
EVSVKPCDCLNGGRCVPRDQARRLAPAEKYFLCFHPGSNCQEDVDECRSGPCLPGGRCVN
VLGSYRCDPCPGAVHGAGQACQNLSRDPIFLTMSSWSPSHPSPAGGAQGRERVLPSPRRG
KRVTSAICRHPCGRGMECVRPNVCRCKAGFSGPSCHTALCCPGCKNHGKCIKPGVCGPWE
GHCGPCIQKASCSPPCRHGGSCLAHNFCSCPYGFVGPRCETAVCTKHCEHGGQCLAPDVC
QCQRGWFGPTCATALCEPVCLNGGVCHKPNSCLCPTGFFGSRCQNAICSPPCKNGGQCVR
NNVCSCPEGFTGQRCQKTLCDPACLHGGRCVLPNACACQPGYAGALC
Download sequence
Identical sequences G3WMS0
ENSSHAP00000016725 ENSSHAP00000016725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]