SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016772 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016772
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-17
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.095
Further Details:      
 
Domain Number 2 Region: 175-575
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000284
Family Armadillo repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016772   Gene: ENSSHAG00000014269   Transcript: ENSSHAT00000016914
Sequence length 825
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834734.1:1431834:1524166:1 gene:ENSSHAG00000014269 transcript:ENSSHAT00000016914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTRRRGKVYTLNEDRQWDDRGTGHVSSTYVERLKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEE
RFEEMPETSHLIDLPTCELNKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQ
VCENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHRE
FLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFYTTLSYFFFFNYK
LRSFSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTL
AKLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDILLINVV
IEQMICDTDPELGGAVQLMGLLRTLIDPENMLATANKTEKSEFLNFFYNHCMHVLTAPLL
ANTSEDKCEKDEIVGANKSNTVCPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDL
LRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNKTMPKIHCIVSSEVHTRK
FNNGGSFVLINIFIFLGKEDIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDRQS
QKLNSVPSILRSNRFRRDARTLEEDEEMWFNEDEEEEGEAVVPPGEKSKPEDDFPDSYEK
FMETKKAKESEDKENLPKRTSSGGFKFTFSHSASAANGANSANSKSVAAQTTPASSNGSS
SKNTSLTTSVTATKGSLVGLVDYPDDEEEEEEEETSPRKRPRLGS
Download sequence
Identical sequences G3WMW7
ENSSHAP00000016772 ENSSHAP00000016772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]