SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016777 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016777
Domain Number 1 Region: 28-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 245-436
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.55e-38
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 3 Region: 440-614
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-31
Family Laminin G-like module 0.0052
Further Details:      
 
Domain Number 4 Region: 647-682
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000244
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016777   Gene: ENSSHAG00000014272   Transcript: ENSSHAT00000016919
Sequence length 683
Comment pep:novel scaffold:DEVIL7.0:GL834739.1:1432427:1547115:1 gene:ENSSHAG00000014272 transcript:ENSSHAT00000016919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAK
KTGSISFDFRTTEPNGLILFSHGKPRHQKDAKNPQMVKVDFFAIEMLDGHLYLLLDMGSG
TIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDDLYLGGLP
ENKAGLIFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSRETAKP
CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEA
EDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF
AGNNLNDNEWHTVRVVRRGKSLKLMVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLS
SVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALA
TLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSS
NKPLNDNQWHNVMISRDTNNLHTVKIDTKITTQSTAGARNLDLKTEIYISLISGEQVKTP
PLVVHQRSHFSGCMCGNIITQTIPELFGSLSYFCNFQIESGAKRPSTTCQEDSCSNQGVC
LQQWDGFSCDCSMTSFSGPLCND
Download sequence
Identical sequences G3WMX2
ENSSHAP00000016777 ENSSHAP00000016777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]