SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016778 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016778
Domain Number 1 Region: 227-359
Classification Level Classification E-value
Superfamily SH3-domain 9.58e-32
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 2 Region: 141-244
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-16
Family PDZ domain 0.001
Further Details:      
 
Domain Number 3 Region: 89-142
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000159
Family L27 domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016778   Gene: ENSSHAG00000014273   Transcript: ENSSHAT00000016920
Sequence length 444
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856829.1:1432522:1445135:-1 gene:ENSSHAG00000014273 transcript:ENSSHAT00000016920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSPLLHFPTAMQQVLDNLGTFPNATGAAELDLIFLRGIMESPIVRSLAKVLLYTWKCSL
FFFSYFVFNFKFFNAHERLEETKLEAVRDNNLELVQEILQDLAELAEQSSTAAELAHILQ
EPHFQSLLETHDSVASKSYETPPPSPGLDPMFNNQPVPPDAVRMVGIRKTAGEHLGVTFR
VEGGELVIARILHGGMVAQQGLLHVGDVIKEVNGQPVGSDPRGLQELLRSASGSVILKIL
PSYQEPHLPRQVFVKCHFDYEPARDSLIPCKEAGLRFCAGDLLQIVNQDDANWWQACHVE
GGSAGLIPSQLLEEKRKAFVKRDLEMTPTSGALCGSISGKKKKRMMYLTTKNAEFDRHEL
LIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDQDRYGTTVPCELMLGGHYNPRE
GTRWSSRHWFTFVSFSAPRAWSCP
Download sequence
Identical sequences G3WMX3
ENSSHAP00000016778 ENSSHAP00000016778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]