SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016823 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016823
Domain Number 1 Region: 736-828
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.49e-27
Family Tudor domain 0.0012
Further Details:      
 
Domain Number 2 Region: 515-609
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.99e-25
Family Tudor domain 0.002
Further Details:      
 
Domain Number 3 Region: 965-1059
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.77e-24
Family Tudor domain 0.002
Further Details:      
 
Domain Number 4 Region: 285-379
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.26e-20
Family Tudor domain 0.0013
Further Details:      
 
Domain Number 5 Region: 158-204
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000106
Family MYND zinc finger 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016823   Gene: ENSSHAG00000014311   Transcript: ENSSHAT00000016965
Sequence length 1181
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834463.1:1446571:1520077:-1 gene:ENSSHAG00000014311 transcript:ENSSHAT00000016965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMSRNNSDISACKVTEQLNIERNEIKPPHEPLRSPRSYPNFKLKSPEHGSKTVGIAKKNF
LFCEQTKRYFASCENSSPPSNSNCINKEAVGSKIDKKTSTGNSVATLNIGNNLPTKELNT
KLSTHLSPAKPKMLQNLSENPLSLNYDSKLFNSLIPSPRSTTCHRCGLYGSLRCSQCKQT
YYCCVACQRRDWSAHSIVCKPIKQNFPKPDDTKLSCETKKMEVNKEDDYQLGITTEIIGS
TKKIMFSDLQNLQLRKTMEIKGTVTEFKHPGEFYIQICSSEVLEYIRKLSTSLKESYMNM
MPQEEYIPIKGEICVAKYSVDQTWNRVIVQDVDVQQKKAQVLYIDYGNGEVIPISRIQQL
NKNIELFPPCAIKCFVANVIPAEGSWNNDCTNAIKPLLVEQYCSLKILDILQEEIISFAV
DVLLPGSGKHLDHVLLEMGYGLRPKGQNSKMQSSDKSDFEDSGEKTSKDKTTTECKSNLI
PKVLSLNVGDEFCGVVAHIQTPEDFFCQQLQSGRQLAELQLSLSEYCNKMSTQSDFYPAI
GDICCAQFSEDNQWYRASVLAYASEESALVGYVDYGNFEILKLNRLCPMAPRLLELPMQA
IKCILAGVKPSSGIWSPEAICLMKKLIRNKMITVKVVDKKENSSVVELIDKSIKPSISVS
KILIEAGFAVGEVTVEKRDGPLKTSIAPLTVEETVNTFEWTWVELAVNETVNVMVCMLYN
PGEFYCHILKEDALSGLNEVNRSLAEYCQQKMPNEFKPEIGEPCCAYFTGDGNWYRALVK
EILPNATVKVHFVDYGNIEEVTVDKLRKMSSKFLKLPFQGIRCWLVDIKPRNKHWSKEAT
ARFQMCVAGIKLKAKIVDLTDNGAGVELTDPSTAYPKIISDILIDEHLVLKDEPPCKDTQ
NSKPVDLPFDPDVLQVHQVQISPTTSSDQWKTIEFPVDEIVPACILEIISPSLFYALPIE
SRADQEKLNLMTVKLTDHCNSQKNRALFKPRIGDVCCARFTSDNYWYRAIILKVSESEVK
VLYADYGNIETLPFSRIQPITTIYLELPFQIIRCSFEGIMELEGGWSPLVLEQLKKLMLN
QNVMISVKGIIKNVHAVSVEKRSENGTINIADKLVMEGLAKHIATKNQSVLNKERTEIEG
QTNCCCTELRKQVEKHEQILLFLLNNPTNQDKFTEMKKLLK
Download sequence
Identical sequences G3WN18
ENSSHAP00000016823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]